Pteropus alecto (black flying fox): 102887632 Help Entry 102887632         CDS       T02993                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pale  Pteropus alecto (black flying fox) Pathway pale01523   Antifolate resistance pale04010   MAPK signaling pathway pale04060   Cytokine-cytokine receptor interaction pale04061   Viral protein interaction with cytokine and cytokine receptor pale04064   NF-kappa B signaling pathway pale04071   Sphingolipid signaling pathway pale04150   mTOR signaling pathway pale04210   Apoptosis pale04217   Necroptosis pale04350   TGF-beta signaling pathway pale04380   Osteoclast differentiation pale04612   Antigen processing and presentation pale04620   Toll-like receptor signaling pathway pale04621   NOD-like receptor signaling pathway pale04622   RIG-I-like receptor signaling pathway pale04625   C-type lectin receptor signaling pathway pale04640   Hematopoietic cell lineage pale04650   Natural killer cell mediated cytotoxicity pale04657   IL-17 signaling pathway pale04660   T cell receptor signaling pathway pale04664   Fc epsilon RI signaling pathway pale04668   TNF signaling pathway pale04920   Adipocytokine signaling pathway pale04930   Type II diabetes mellitus pale04931   Insulin resistance pale04932   Non-alcoholic fatty liver disease pale04933   AGE-RAGE signaling pathway in diabetic complications pale04936   Alcoholic liver disease pale04940   Type I diabetes mellitus pale05010   Alzheimer disease pale05014   Amyotrophic lateral sclerosis pale05020   Prion disease pale05022   Pathways of neurodegeneration - multiple diseases pale05132   Salmonella infection pale05133   Pertussis pale05134   Legionellosis pale05135   Yersinia infection pale05140   Leishmaniasis pale05142   Chagas disease pale05143   African trypanosomiasis pale05144   Malaria pale05145   Toxoplasmosis pale05146   Amoebiasis pale05152   Tuberculosis pale05160   Hepatitis C pale05161   Hepatitis B pale05163   Human cytomegalovirus infection pale05164   Influenza A pale05165   Human papillomavirus infection pale05166   Human T-cell leukemia virus 1 infection pale05168   Herpes simplex virus 1 infection pale05169   Epstein-Barr virus infection pale05170   Human immunodeficiency virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05205   Proteoglycans in cancer pale05310   Asthma pale05321   Inflammatory bowel disease pale05322   Systemic lupus erythematosus pale05323   Rheumatoid arthritis pale05330   Allograft rejection pale05332   Graft-versus-host disease pale05410   Hypertrophic cardiomyopathy pale05414   Dilated cardiomyopathy pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102887632 (TNF)    04350 TGF-beta signaling pathway     102887632 (TNF)    04064 NF-kappa B signaling pathway     102887632 (TNF)    04668 TNF signaling pathway     102887632 (TNF)    04071 Sphingolipid signaling pathway     102887632 (TNF)    04150 mTOR signaling pathway     102887632 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102887632 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     102887632 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102887632 (TNF)    04217 Necroptosis     102887632 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102887632 (TNF)    04620 Toll-like receptor signaling pathway     102887632 (TNF)    04621 NOD-like receptor signaling pathway     102887632 (TNF)    04622 RIG-I-like receptor signaling pathway     102887632 (TNF)    04625 C-type lectin receptor signaling pathway     102887632 (TNF)    04650 Natural killer cell mediated cytotoxicity     102887632 (TNF)    04612 Antigen processing and presentation     102887632 (TNF)    04660 T cell receptor signaling pathway     102887632 (TNF)    04657 IL-17 signaling pathway     102887632 (TNF)    04664 Fc epsilon RI signaling pathway     102887632 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102887632 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     102887632 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102887632 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102887632 (TNF)    05170 Human immunodeficiency virus 1 infection     102887632 (TNF)    05161 Hepatitis B     102887632 (TNF)    05160 Hepatitis C     102887632 (TNF)    05171 Coronavirus disease - COVID-19     102887632 (TNF)    05164 Influenza A     102887632 (TNF)    05168 Herpes simplex virus 1 infection     102887632 (TNF)    05163 Human cytomegalovirus infection     102887632 (TNF)    05169 Epstein-Barr virus infection     102887632 (TNF)    05165 Human papillomavirus infection     102887632 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     102887632 (TNF)    05135 Yersinia infection     102887632 (TNF)    05133 Pertussis     102887632 (TNF)    05134 Legionellosis     102887632 (TNF)    05152 Tuberculosis     102887632 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     102887632 (TNF)    05144 Malaria     102887632 (TNF)    05145 Toxoplasmosis     102887632 (TNF)    05140 Leishmaniasis     102887632 (TNF)    05142 Chagas disease     102887632 (TNF)    05143 African trypanosomiasis     102887632 (TNF)   09163 Immune disease    05310 Asthma     102887632 (TNF)    05322 Systemic lupus erythematosus     102887632 (TNF)    05323 Rheumatoid arthritis     102887632 (TNF)    05321 Inflammatory bowel disease     102887632 (TNF)    05330 Allograft rejection     102887632 (TNF)    05332 Graft-versus-host disease     102887632 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     102887632 (TNF)    05014 Amyotrophic lateral sclerosis     102887632 (TNF)    05020 Prion disease     102887632 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     102887632 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102887632 (TNF)    05418 Fluid shear stress and atherosclerosis     102887632 (TNF)    05410 Hypertrophic cardiomyopathy     102887632 (TNF)    05414 Dilated cardiomyopathy     102887632 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102887632 (TNF)    04940 Type I diabetes mellitus     102887632 (TNF)    04936 Alcoholic liver disease     102887632 (TNF)    04932 Non-alcoholic fatty liver disease     102887632 (TNF)    04931 Insulin resistance     102887632 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     102887632 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102887632 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102887632 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102887632 (TNF) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Tumor necrosis fators    102887632 (TNF) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Cytokines    102887632 (TNF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  102887632 NCBI-ProteinID:  XP_006904731 UniProt:  L5L5E4 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSTESMIRDVELAEEELPKKAGGPQASRRCLCLSLFSFLLVAGATMLFCLLHFGVIGPQR EEFPTGLPLIKPLAQTLGLSSRTPSDKPVAHVVANPQAEGQLQWLSQRANALLANGMKLT DNQLVVPLDGLYLIYSQVLFKGQGCPQTHVLLTHTISRFADSYQTKVNLLSAIKSPCQRE TQEGAAAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggctgaggaggaactccccaagaag gcaggggggccccaggcctccagacggtgcctgtgcctcagcctcttctccttcctcctc gtggcaggagccaccatgctcttctgcctgctgcacttcggagtgattggcccccagaga gaagagttcccgactggcctcccactaatcaaacctctggcccagactcttggattatct tctcgaaccccaagtgacaagcctgtcgcccatgttgtagcaaacccccaagccgaggga cagctccagtggctgagccagcgtgccaatgctctcctggccaatggcatgaagctgaca gacaaccagctggtggtgccattagatgggctgtacctcatctactcccaggtcctcttc aaaggtcaaggctgccctcaaacccatgtactcctcacccacaccatcagccgcttcgct gactcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggaa acccaagagggggctgcggccaagccctggtatgagcccatctacctgggaggagtcttc cagctagagaagggtgatcgactcagtgccgagatcaacctgcctgactatcttgacttt gctgagtctgggcaggtctactttgggatcattgccttgtga

DBGET integrated database retrieval system