Pteropus alecto (black flying fox): 102890025 Help Entry 102890025         CDS       T02993                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism pale  Pteropus alecto (black flying fox) Pathway pale04060   Cytokine-cytokine receptor interaction pale04151   PI3K-Akt signaling pathway pale04630   JAK-STAT signaling pathway pale04640   Hematopoietic cell lineage pale04657   IL-17 signaling pathway pale04658   Th1 and Th2 cell differentiation pale04659   Th17 cell differentiation pale04660   T cell receptor signaling pathway pale04664   Fc epsilon RI signaling pathway pale04672   Intestinal immune network for IgA production pale05140   Leishmaniasis pale05200   Pathways in cancer pale05310   Asthma pale05320   Autoimmune thyroid disease pale05321   Inflammatory bowel disease pale05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102890025 (IL4)    04151 PI3K-Akt signaling pathway     102890025 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102890025 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102890025 (IL4)    04660 T cell receptor signaling pathway     102890025 (IL4)    04658 Th1 and Th2 cell differentiation     102890025 (IL4)    04659 Th17 cell differentiation     102890025 (IL4)    04657 IL-17 signaling pathway     102890025 (IL4)    04664 Fc epsilon RI signaling pathway     102890025 (IL4)    04672 Intestinal immune network for IgA production     102890025 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102890025 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102890025 (IL4)   09163 Immune disease    05310 Asthma     102890025 (IL4)    05320 Autoimmune thyroid disease     102890025 (IL4)    05321 Inflammatory bowel disease     102890025 (IL4)    05330 Allograft rejection     102890025 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pale04052]     102890025 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pale00536]     102890025 (IL4) Cytokines and neuropeptides [BR:pale04052]  Cytokines   Interleukins    102890025 (IL4) Glycosaminoglycan binding proteins [BR:pale00536]  Heparan sulfate / Heparin   Cytokines    102890025 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 DUF4942 AAR2 RHS_N Motif Other DBs NCBI-GeneID:  102890025 NCBI-ProteinID:  XP_006923210 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MGLTSQLIPALVCLLACTSNFTHGHRYSITLEEIIKTLNILTTRKDWCMELMVADVFAAP KNTAEDEIFCRAVTVLRKVYKHHECVNRKFLGKLDRNLRSMARDYCPVEEAKKDTLKNVL ETLRKTMQEKYSKSWS NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgattccagctctggtgtgcttactagcatgtaccagcaac ttcacccatggacacaggtacagtatcaccttagaagagatcatcaaaacgctgaacatc ctcacaacgagaaaggactggtgcatggagctgatggtggcggacgtcttcgctgcccca aagaacacagcggaggatgaaatcttctgcagggctgtgacggtgcttcggaaggtctac aaacaccatgagtgcgtaaacagaaaattcctgggcaaacttgacaggaacctgcgcagc atggccagggactactgtcctgtggaggaagccaagaaggatacattgaaaaacgtcttg gaaacgctaaggaagaccatgcaagagaaatactcaaagagttggagctga

DBGET integrated database retrieval system