Pteropus alecto (black flying fox): 102891428 Help Entry 102891428         CDS       T02993                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pale  Pteropus alecto (black flying fox) Pathway pale01522   Endocrine resistance pale04010   MAPK signaling pathway pale04024   cAMP signaling pathway pale04210   Apoptosis pale04380   Osteoclast differentiation pale04620   Toll-like receptor signaling pathway pale04657   IL-17 signaling pathway pale04658   Th1 and Th2 cell differentiation pale04659   Th17 cell differentiation pale04660   T cell receptor signaling pathway pale04662   B cell receptor signaling pathway pale04668   TNF signaling pathway pale04713   Circadian entrainment pale04725   Cholinergic synapse pale04728   Dopaminergic synapse pale04915   Estrogen signaling pathway pale04917   Prolactin signaling pathway pale04921   Oxytocin signaling pathway pale04926   Relaxin signaling pathway pale04928   Parathyroid hormone synthesis, secretion and action pale04932   Non-alcoholic fatty liver disease pale04935   Growth hormone synthesis, secretion and action pale05031   Amphetamine addiction pale05132   Salmonella infection pale05133   Pertussis pale05135   Yersinia infection pale05140   Leishmaniasis pale05142   Chagas disease pale05161   Hepatitis B pale05162   Measles pale05166   Human T-cell leukemia virus 1 infection pale05167   Kaposi sarcoma-associated herpesvirus infection pale05170   Human immunodeficiency virus 1 infection pale05171   Coronavirus disease - COVID-19 pale05200   Pathways in cancer pale05207   Chemical carcinogenesis - receptor activation pale05208   Chemical carcinogenesis - reactive oxygen species pale05210   Colorectal cancer pale05224   Breast cancer pale05231   Choline metabolism in cancer pale05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pale05323   Rheumatoid arthritis pale05417   Lipid and atherosclerosis pale05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102891428 (FOS)    04668 TNF signaling pathway     102891428 (FOS)    04024 cAMP signaling pathway     102891428 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102891428 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102891428 (FOS)    04660 T cell receptor signaling pathway     102891428 (FOS)    04658 Th1 and Th2 cell differentiation     102891428 (FOS)    04659 Th17 cell differentiation     102891428 (FOS)    04657 IL-17 signaling pathway     102891428 (FOS)    04662 B cell receptor signaling pathway     102891428 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     102891428 (FOS)    04917 Prolactin signaling pathway     102891428 (FOS)    04921 Oxytocin signaling pathway     102891428 (FOS)    04926 Relaxin signaling pathway     102891428 (FOS)    04935 Growth hormone synthesis, secretion and action     102891428 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     102891428 (FOS)   09156 Nervous system    04725 Cholinergic synapse     102891428 (FOS)    04728 Dopaminergic synapse     102891428 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     102891428 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     102891428 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102891428 (FOS)    05207 Chemical carcinogenesis - receptor activation     102891428 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     102891428 (FOS)    05231 Choline metabolism in cancer     102891428 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102891428 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     102891428 (FOS)    05224 Breast cancer     102891428 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102891428 (FOS)    05170 Human immunodeficiency virus 1 infection     102891428 (FOS)    05161 Hepatitis B     102891428 (FOS)    05171 Coronavirus disease - COVID-19     102891428 (FOS)    05162 Measles     102891428 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     102891428 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102891428 (FOS)    05135 Yersinia infection     102891428 (FOS)    05133 Pertussis     102891428 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102891428 (FOS)    05142 Chagas disease     102891428 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     102891428 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     102891428 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102891428 (FOS)    05418 Fluid shear stress and atherosclerosis     102891428 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102891428 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102891428 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pale03000]     102891428 (FOS)    04131 Membrane trafficking [BR:pale04131]     102891428 (FOS) Transcription factors [BR:pale03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     102891428 (FOS) Membrane trafficking [BR:pale04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102891428 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 HALZ Macoilin Motif Other DBs NCBI-GeneID:  102891428 NCBI-ProteinID:  XP_006925520 UniProt:  L5JSB2 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNGQDFCTDLASSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGSRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSMASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPAKNISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCATYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctccggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccagccggggacagtctctcctactaccactcaccggctgactctttctccagcatg ggctctcctgtcaacggacaggacttctgcactgatctggcctcctccagtgccaacttc atcccaactgtgactgccatctcaaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcccagaccagagcccctcacccctatggagttcccacc ccctcagctggggcttactccagagctggagtcatgaagactgtgacaggaagcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaggaagagaaaagg agaatccgtagagaaaggaataagatggctgcagccaaatgcaggaaccggagaagggag ctgactgacacactccaagcggagacagaccaattagaagatgagaagtctgctttgcag actgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacctaggcttcccagaagagatgtctatggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgagtctgaggaggccttcacc ctgcccctcctcaatgaccctgagcctaagccctcagtggagcctgccaagaacatcagc agcatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agtggctctgagaccgcccgctctgtgccagacatggatctgtctggttccttctatgca gcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcgctacttacacgtcttcc tttgtcttcacctatcccgaagctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcactgagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system