KEGG   Parasphingopyxis algicola: HFP57_16220
Entry
HFP57_16220       CDS       T06669                                 
Name
(GenBank) catechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
palg  Parasphingopyxis algicola
Pathway
palg00361  Chlorocyclohexane and chlorobenzene degradation
palg01100  Metabolic pathways
palg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:palg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    HFP57_16220
Enzymes [BR:palg01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     HFP57_16220
SSDB
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg Big_1
Other DBs
NCBI-ProteinID: QLC26422
LinkDB
Position
3279775..3280572
AA seq 265 aa
MRKEVEVANNRLDQIVSTIVDKVRQGVIEEGVTFEEYRAAIGYIMKISEAGELPLFIDVF
LNTTVVSVINQNSHPNASPSDMEGPYFLDDAPFVKNGKIKTMDEYKDDEPMVVRGTVKDV
DGNPLPGVVIDMWSSTPDGKYGGIHDNIPVDYYRGKVKTDENGQFEAESTVPVPYRIPDS
GPVGAMLEMMGRHSWRPAHVHLKVRHPGYRELITQLYFEEDEYVHSDCCEGIVPAEFVYP
RIVEDGKRVLEADLVIEPVAQQQAA
NT seq 798 nt   +upstreamnt  +downstreamnt
atgcggaaggaagtggaagtggccaataatcgtttggatcagatcgtcagcacaatcgtg
gacaaggtccgtcagggcgtcatcgaggaaggcgtgactttcgaagaatatcgcgccgcg
atcggctatatcatgaagatatccgaggccggtgaattgcctctgttcatcgatgttttc
ctcaacacgaccgtggtcagcgttattaaccagaacagccatcccaatgcgtccccgtcc
gatatggagggcccctattttctcgatgacgcgcctttcgtcaaaaatgggaaaatcaag
acgatggacgagtataaggacgatgagccgatggttgtgcgcggcaccgtcaaggatgtg
gacggcaatccgctgccgggtgtcgttatcgacatgtggagctcgacgccggacggcaaa
tatggcggcattcacgacaatatcccggtcgactattatcgcggcaaggtgaagaccgac
gagaatggccagttcgaagcggaaagcaccgtcccggttccatatcgaattcccgatagc
ggcccggtcggcgcgatgctggaaatgatggggcggcacagctggcgcccggcccatgtc
catttgaaagtgcgccatcccggatatcgcgaactgatcacccagctctatttcgaggaa
gacgaatatgtgcacagcgattgctgcgaaggcatcgtgccggccgagttcgtctatccg
cgcatcgtcgaagacggcaagcgcgttctcgaagcggatttggtgatagaaccggtcgcc
cagcaacaggctgcctga

DBGET integrated database retrieval system