Populus alba (white poplar): 118047972 Help Entry 118047972         CDS       T07314                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism palz  Populus alba (white poplar) Pathway palz00510   N-Glycan biosynthesis palz00513   Various types of N-glycan biosynthesis palz04141   Protein processing in endoplasmic reticulum Module palz_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:palz00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118047972    00513 Various types of N-glycan biosynthesis     118047972  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118047972 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  118047972 NCBI-ProteinID:  XP_034913342 LinkDB All DBs Position 6:complement(12893017..12894274) Genome browser AA seq 78 aa AA seqDB search MGSKGAAITSPVPVTWYPTLAIFMLAIGLMVSASFFIYEATSSRRNRSLAKELTTGALAS FFLGFGSLFMLLASGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggttcgaagggagcagcaataacgagtccagtcccggtgacatggtacccaacccta gcaatcttcatgctggccatcggccttatggtctctgcttccttcttcatctacgaagcg acctcttctaggagaaatcgcagtttggccaaggagcttactacaggagcattggcctca ttctttctgggttttgggtccttgttcatgctacttgcttctggtgtttatgtctga

DBGET integrated database retrieval system