Populus alba (white poplar): 118062236 Help Entry 118062236         CDS       T07314                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism palz  Populus alba (white poplar) Pathway palz03018   RNA degradation palz03040   Spliceosome Brite KEGG Orthology (KO) [BR:palz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     118062236   09123 Folding, sorting and degradation    03018 RNA degradation     118062236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:palz03019]     118062236    03041 Spliceosome [BR:palz03041]     118062236 Messenger RNA biogenesis [BR:palz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      118062236   mRNA degradation factors    5'-3' decay     Lsm complex      118062236 Spliceosome [BR:palz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     118062236  Complex C   U2 snRNP components     118062236 SSDB OrthologParalogGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  118062236 NCBI-ProteinID:  XP_034931863 LinkDB All DBs Position 5:complement(18394326..18396513) Genome browser AA seq 97 aa AA seqDB search MASEEESAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTTVE IDDETYEEIVRTTRRTVPFLFVRGDGVILVSPPLRTA NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgaagaagagagtgcggtaaaagaaccattggatctcatcagacttagcctg gacgagcgtatctacgtcaagctccgctctgatcgtgagcttcgcggcaaacttcacgct tatgatcagcatttgaatatgattcttggggatgttgaagaaattgttactacagtagaa atcgatgatgaaacctatgaagagattgttcggactacaaggcgcacagtgcccttcctg tttgttagaggagatggtgtcatattggtctctcctccattgaggacagcttaa

DBGET integrated database retrieval system