Pantoea sp. SO10: FCN45_03230 Help Entry FCN45_03230       CDS       T06053                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pans  Pantoea sp. SO10 Pathway pans00670   One carbon pool by folate pans00790   Folate biosynthesis pans01100   Metabolic pathways pans01240   Biosynthesis of cofactors pans04981   Folate transport and metabolism Module pans_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pans00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FCN45_03230 (folA)    00670 One carbon pool by folate     FCN45_03230 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     FCN45_03230 (folA) Enzymes [BR:pans01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      FCN45_03230 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QCP58454 LinkDB All DBs Position 713378..713860 Genome browser AA seq 160 aa AA seqDB search MISLIAALAADRIIGMENAMPWNLPADLAWFKRNTLNKPVIMGRLTFESIGRPLPGRLNI VVSSQPGNHEGVTWVTSLEEAVKAAGDVEEMMVIGGGRVYEQMLARADRLYLTHIDAEVE GDTQFPDYEPDEWQSTFSEFHDADEQNSHSYCFEILDRRT NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattagtctgatcgcggcactggcagcggatcgcattattggtatggaaaacgccatg ccatggaacctgccagcagatttggcatggttcaaacgtaataccttgaataagccggtg attatgggtcgtctgacctttgaatcgataggccgcccgcttcctggacgcctgaacatt gtggtcagcagccagccgggcaaccatgaaggcgtcacttgggtgacatcgctggaagag gcggtaaaagcggcgggtgatgtcgaagagatgatggtgattggtggtgggcgcgtttac gagcagatgctggctcgcgcggatcgcctctacctgacccatatcgatgcggaagtggaa ggggatacgcagttcccggattacgaaccggacgagtggcagtcaaccttcagcgaattc catgacgccgatgagcagaactcgcacagctactgcttcgagatcctggatcgccgcacg taa

DBGET integrated database retrieval system