Papio anubis (olive baboon): 100126724 Help Entry 100126724         CDS       T07474                                  Symbol IFNG Name (RefSeq) interferon gamma precursor   KO K04687   interferon gamma Organism panu  Papio anubis (olive baboon) Pathway panu03050   Proteasome panu04060   Cytokine-cytokine receptor interaction panu04066   HIF-1 signaling pathway panu04217   Necroptosis panu04350   TGF-beta signaling pathway panu04380   Osteoclast differentiation panu04612   Antigen processing and presentation panu04630   JAK-STAT signaling pathway panu04650   Natural killer cell mediated cytotoxicity panu04657   IL-17 signaling pathway panu04658   Th1 and Th2 cell differentiation panu04659   Th17 cell differentiation panu04660   T cell receptor signaling pathway panu04940   Type I diabetes mellitus panu05140   Leishmaniasis panu05142   Chagas disease panu05143   African trypanosomiasis panu05144   Malaria panu05145   Toxoplasmosis panu05146   Amoebiasis panu05152   Tuberculosis panu05160   Hepatitis C panu05164   Influenza A panu05168   Herpes simplex virus 1 infection panu05200   Pathways in cancer panu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer panu05321   Inflammatory bowel disease panu05322   Systemic lupus erythematosus panu05323   Rheumatoid arthritis panu05330   Allograft rejection panu05332   Graft-versus-host disease panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     100126724 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     100126724 (IFNG)    04630 JAK-STAT signaling pathway     100126724 (IFNG)    04066 HIF-1 signaling pathway     100126724 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100126724 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100126724 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     100126724 (IFNG)    04612 Antigen processing and presentation     100126724 (IFNG)    04660 T cell receptor signaling pathway     100126724 (IFNG)    04658 Th1 and Th2 cell differentiation     100126724 (IFNG)    04659 Th17 cell differentiation     100126724 (IFNG)    04657 IL-17 signaling pathway     100126724 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     100126724 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100126724 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100126724 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     100126724 (IFNG)    05164 Influenza A     100126724 (IFNG)    05168 Herpes simplex virus 1 infection     100126724 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     100126724 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     100126724 (IFNG)    05144 Malaria     100126724 (IFNG)    05145 Toxoplasmosis     100126724 (IFNG)    05140 Leishmaniasis     100126724 (IFNG)    05142 Chagas disease     100126724 (IFNG)    05143 African trypanosomiasis     100126724 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     100126724 (IFNG)    05323 Rheumatoid arthritis     100126724 (IFNG)    05321 Inflammatory bowel disease     100126724 (IFNG)    05330 Allograft rejection     100126724 (IFNG)    05332 Graft-versus-host disease     100126724 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100126724 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100126724 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:panu03051]     100126724 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     100126724 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:panu00536]     100126724 (IFNG) Proteasome [BR:panu03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     100126724 (IFNG) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interferons    100126724 (IFNG) Glycosaminoglycan binding proteins [BR:panu00536]  Heparan sulfate / Heparin   Cytokines    100126724 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma Motif Other DBs NCBI-GeneID:  100126724 NCBI-ProteinID:  NP_001106110 Ensembl:  ENSPANG00000000228 UniProt:  Q865Y4 LinkDB All DBs Position 9:complement(62498451..62502670) Genome browser AA seq 165 aa AA seqDB search MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAVDPDVADNGTLFLDILRNWK EESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKWDDFEKLTN YSVTDLNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgaaatatacaagttatatcttggcttttcagctctgcattgttttgggttctcttggc tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca gttgatccagatgtagcagataatggaactcttttcttagacatcttgaggaattggaaa gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt aaaaacttcaaagatgaccagaggatccaaaagagtgtggagaccatcaaggaagacatt aatgtcaagtttttcaatagcaacaaaaagaaatgggatgacttcgaaaagctgaccaat tattcggtaactgacttgaatgtccaacgcaaagcagtacatgaactcatccaagtgatg gctgaactgtcgccagcagctaaaatagggaagcgaaaaaggagtcagatgtttcgaggt cgaagagcatcccaataa

DBGET integrated database retrieval system