Papio anubis (olive baboon): 100126747 Help Entry 100126747         CDS       T07474                                  Symbol IL4 Name (RefSeq) interleukin-4 precursor   KO K05430   interleukin 4 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04151   PI3K-Akt signaling pathway panu04630   JAK-STAT signaling pathway panu04640   Hematopoietic cell lineage panu04657   IL-17 signaling pathway panu04658   Th1 and Th2 cell differentiation panu04659   Th17 cell differentiation panu04660   T cell receptor signaling pathway panu04664   Fc epsilon RI signaling pathway panu04672   Intestinal immune network for IgA production panu05140   Leishmaniasis panu05200   Pathways in cancer panu05310   Asthma panu05320   Autoimmune thyroid disease panu05321   Inflammatory bowel disease panu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100126747 (IL4)    04151 PI3K-Akt signaling pathway     100126747 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100126747 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100126747 (IL4)    04660 T cell receptor signaling pathway     100126747 (IL4)    04658 Th1 and Th2 cell differentiation     100126747 (IL4)    04659 Th17 cell differentiation     100126747 (IL4)    04657 IL-17 signaling pathway     100126747 (IL4)    04664 Fc epsilon RI signaling pathway     100126747 (IL4)    04672 Intestinal immune network for IgA production     100126747 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100126747 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100126747 (IL4)   09163 Immune disease    05310 Asthma     100126747 (IL4)    05320 Autoimmune thyroid disease     100126747 (IL4)    05321 Inflammatory bowel disease     100126747 (IL4)    05330 Allograft rejection     100126747 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     100126747 (IL4)    00536 Glycosaminoglycan binding proteins [BR:panu00536]     100126747 (IL4) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interleukins    100126747 (IL4) Glycosaminoglycan binding proteins [BR:panu00536]  Heparan sulfate / Heparin   Cytokines    100126747 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 DUF1907 Motif Other DBs NCBI-GeneID:  100126747 NCBI-ProteinID:  NP_001106123 Ensembl:  ENSPANG00000004677 UniProt:  Q865Y0 LinkDB All DBs Position 5:125436445..125444801 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFAHGHNCHIALREIIETLNSLTEQKTLCTKLTITDILAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL NSCPVKEASQSTLEDFLERLKTIMKEKYSKCRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac tttgcccacggacacaactgccatatcgccttacgggagatcatcgaaactctgaacagc ctcacagagcagaagactctgtgcaccaagttgaccataacggacatccttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg aactcctgtcctgtgaaggaagccagccagagtacgttggaagacttcttggaaaggcta aagacgatcatgaaagagaaatattcaaagtgtcggcgctga

DBGET integrated database retrieval system