Papio anubis (olive baboon): 100381195 Help Entry 100381195         CDS       T07474                                  Symbol IL6 Name (RefSeq) interleukin-6 precursor   KO K05405   interleukin 6 Organism panu  Papio anubis (olive baboon) Pathway panu01521   EGFR tyrosine kinase inhibitor resistance panu01523   Antifolate resistance panu04060   Cytokine-cytokine receptor interaction panu04061   Viral protein interaction with cytokine and cytokine receptor panu04066   HIF-1 signaling pathway panu04068   FoxO signaling pathway panu04151   PI3K-Akt signaling pathway panu04218   Cellular senescence panu04620   Toll-like receptor signaling pathway panu04621   NOD-like receptor signaling pathway panu04623   Cytosolic DNA-sensing pathway panu04625   C-type lectin receptor signaling pathway panu04630   JAK-STAT signaling pathway panu04640   Hematopoietic cell lineage panu04657   IL-17 signaling pathway panu04659   Th17 cell differentiation panu04668   TNF signaling pathway panu04672   Intestinal immune network for IgA production panu04931   Insulin resistance panu04932   Non-alcoholic fatty liver disease panu04933   AGE-RAGE signaling pathway in diabetic complications panu04936   Alcoholic liver disease panu05010   Alzheimer disease panu05020   Prion disease panu05022   Pathways of neurodegeneration - multiple diseases panu05132   Salmonella infection panu05133   Pertussis panu05134   Legionellosis panu05135   Yersinia infection panu05142   Chagas disease panu05143   African trypanosomiasis panu05144   Malaria panu05146   Amoebiasis panu05152   Tuberculosis panu05161   Hepatitis B panu05162   Measles panu05163   Human cytomegalovirus infection panu05164   Influenza A panu05166   Human T-cell leukemia virus 1 infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05168   Herpes simplex virus 1 infection panu05169   Epstein-Barr virus infection panu05171   Coronavirus disease - COVID-19 panu05200   Pathways in cancer panu05202   Transcriptional misregulation in cancer panu05321   Inflammatory bowel disease panu05323   Rheumatoid arthritis panu05332   Graft-versus-host disease panu05410   Hypertrophic cardiomyopathy panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100381195 (IL6)    04668 TNF signaling pathway     100381195 (IL6)    04066 HIF-1 signaling pathway     100381195 (IL6)    04068 FoxO signaling pathway     100381195 (IL6)    04151 PI3K-Akt signaling pathway     100381195 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100381195 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     100381195 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100381195 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100381195 (IL6)    04620 Toll-like receptor signaling pathway     100381195 (IL6)    04621 NOD-like receptor signaling pathway     100381195 (IL6)    04623 Cytosolic DNA-sensing pathway     100381195 (IL6)    04625 C-type lectin receptor signaling pathway     100381195 (IL6)    04659 Th17 cell differentiation     100381195 (IL6)    04657 IL-17 signaling pathway     100381195 (IL6)    04672 Intestinal immune network for IgA production     100381195 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100381195 (IL6)    05202 Transcriptional misregulation in cancer     100381195 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100381195 (IL6)    05161 Hepatitis B     100381195 (IL6)    05171 Coronavirus disease - COVID-19     100381195 (IL6)    05164 Influenza A     100381195 (IL6)    05162 Measles     100381195 (IL6)    05168 Herpes simplex virus 1 infection     100381195 (IL6)    05163 Human cytomegalovirus infection     100381195 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     100381195 (IL6)    05169 Epstein-Barr virus infection     100381195 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     100381195 (IL6)    05135 Yersinia infection     100381195 (IL6)    05133 Pertussis     100381195 (IL6)    05134 Legionellosis     100381195 (IL6)    05152 Tuberculosis     100381195 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     100381195 (IL6)    05144 Malaria     100381195 (IL6)    05142 Chagas disease     100381195 (IL6)    05143 African trypanosomiasis     100381195 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     100381195 (IL6)    05321 Inflammatory bowel disease     100381195 (IL6)    05332 Graft-versus-host disease     100381195 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     100381195 (IL6)    05020 Prion disease     100381195 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     100381195 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100381195 (IL6)    05410 Hypertrophic cardiomyopathy     100381195 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100381195 (IL6)    04932 Non-alcoholic fatty liver disease     100381195 (IL6)    04931 Insulin resistance     100381195 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     100381195 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100381195 (IL6)    01523 Antifolate resistance     100381195 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     100381195 (IL6) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interleukins    100381195 (IL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL11 IL23 GCSF Phage_int_SAM_1 Motif Other DBs NCBI-GeneID:  100381195 NCBI-ProteinID:  NP_001167007 Ensembl:  ENSPANG00000000700 UniProt:  C9EI26 A0A096NGM9 LinkDB All DBs Position 4:92797490..92802897 Genome browser AA seq 212 aa AA seqDB search MNSVSTSAFGPVAFSLGLLLVLPAAFPAPVLPGEDSKDVAAPHSQPLTSSERIDKQIRYI LDGISVLRKETCNRSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEDTCLVKIITGLL EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPEPTTNASLLTKLQ AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg gtgttgcctgctgccttccccgcgccagtactcccaggagaagattccaaagatgtagcc gccccacacagccagccactgacctcttcagaacgaattgacaaacaaattcggtacatc ctcgacggcatctcagtcctgagaaaggagacatgtaacaggagtaacatgtgtgaaagc agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga tgcttccaatctggattcaatgaggacacttgcctggtgaaaatcatcactggtcttttg gagtttgaggtatacctagagtacctccagaacaggtttgagagtagtgaggagcaagcc agagctgtgcaaatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat ctagatgcaataaccacccctgaaccaaccacaaatgccagcctgctgacgaagctgcag gcacagaaccagtggctgcaggacatgacgacgcatctcatcctgcgcagctttaaggag ttcctgcagtccagcctgagggctcttcggcaaatgtaa

DBGET integrated database retrieval system