Papio anubis (olive baboon): 101022800 Help Entry 101022800         CDS       T07474                                  Name (RefSeq) growth-regulated alpha protein   KO K05505   C-X-C motif chemokine 1/2/3 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04061   Viral protein interaction with cytokine and cytokine receptor panu04062   Chemokine signaling pathway panu04064   NF-kappa B signaling pathway panu04621   NOD-like receptor signaling pathway panu04657   IL-17 signaling pathway panu04668   TNF signaling pathway panu04936   Alcoholic liver disease panu05134   Legionellosis panu05146   Amoebiasis panu05167   Kaposi sarcoma-associated herpesvirus infection panu05323   Rheumatoid arthritis panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101022800    04668 TNF signaling pathway     101022800   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101022800    04061 Viral protein interaction with cytokine and cytokine receptor     101022800  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     101022800    04657 IL-17 signaling pathway     101022800    04062 Chemokine signaling pathway     101022800  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     101022800   09171 Infectious disease: bacterial    05134 Legionellosis     101022800   09174 Infectious disease: parasitic    05146 Amoebiasis     101022800   09163 Immune disease    05323 Rheumatoid arthritis     101022800   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101022800   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101022800  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101022800 Cytokines and neuropeptides [BR:panu04052]  Cytokines   Chemokines    101022800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101022800 NCBI-ProteinID:  XP_003898812 Ensembl:  ENSPANG00000036029 LinkDB All DBs Position 3:complement(117842739..117844974) Genome browser AA seq 107 aa AA seqDB search MASPALSTTPSNLRLLRVALLLLLLVAASRRAAGASLVTELRCQCLQTLHGIHPKNIQSV NVKAPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIGKMLNNGKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcctcccccgctctctccaccacccctagcaatctccggctcctgcgggtggcgctg ctgcttctgctcctggtggccgccagccggcgcgcagcaggagcgtccctggtcactgaa ctgcgctgccagtgcttgcagaccctgcacggaattcaccccaagaacatccaaagtgtg aatgtgaaggccccaggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaatcccgcatcccccatggttaagaaaatcatcggaaagatg ctgaacaatggcaaatccaactga

DBGET integrated database retrieval system