Papio anubis (olive baboon): 101025211 Help Entry 101025211         CDS       T07474                                  Symbol POLE4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism panu  Papio anubis (olive baboon) Pathway panu03030   DNA replication panu03410   Base excision repair panu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:panu00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101025211 (POLE4)    03410 Base excision repair     101025211 (POLE4)    03420 Nucleotide excision repair     101025211 (POLE4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:panu03032]     101025211 (POLE4)    03400 DNA repair and recombination proteins [BR:panu03400]     101025211 (POLE4) Enzymes [BR:panu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      101025211 (POLE4) DNA replication proteins [BR:panu03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     101025211 (POLE4) DNA repair and recombination proteins [BR:panu03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       101025211 (POLE4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  101025211 NCBI-ProteinID:  XP_003908905 Ensembl:  ENSPANG00000024718 UniProt:  A0A8I5R247 LinkDB All DBs Position 14:75220134..75226797 Genome browser AA seq 117 aa AA seqDB search MAAAAAAGSGTPREEEGPAGEAAALQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAG QEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcagcggcggcggcggcaggaagcgggacaccccgagaggaggagggacctgctggg gaggcagcggccttgcagccccaagccccaacgagtgtgcctggggctcgtctctcgagg ttgcctctggcgcgagtgaaggccttggtgaaggcggaccccgacgtgacgctagcggga caggaagccatcttcattctggcacgagccgcggaactgtttgtggagaccattgcaaaa gatgcctactgttgtgctcagcagggaaaaaggaaaactcttcagaggagagacttggat aatgcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system