Paracoccus jeotgali: CYR75_00605 Help Entry CYR75_00605       CDS       T05276                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism paru  Paracoccus jeotgali Brite KEGG Orthology (KO) [BR:paru00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:paru03110]     CYR75_00605 (grxC) Chaperones and folding catalysts [BR:paru03110]  Protein folding catalysts   Protein disulfide isomerase    CYR75_00605 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Thioredoxin_3 SH3BGR Thioredoxin_2 Motif Other DBs NCBI-ProteinID:  AUM73002 UniProt:  A0A2K9MBW5 LinkDB All DBs Position 118800..119057 Genome browser AA seq 85 aa AA seqDB search MAKIEIYTTPTCPYCHSAKALLNRKSADFTEIDVSRDPSLRDAMTKRASGRRSVPQIFID GQHVGGSDELHALDRRGALDPMLAG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcgaagatcgagatctataccacgcccacctgcccttattgccattcggccaaggcg ctgctgaaccgcaaaagcgccgatttcaccgagatcgacgtcagccgcgacccctcgctg cgcgacgcgatgaccaagcgggccagcggccggcgcagcgtgccgcagattttcatcgat ggtcagcatgtcggcggctcggacgagcttcatgcgctggaccggcgcggtgcgctcgac ccgatgctggcgggatag

DBGET integrated database retrieval system