Prunus avium (sweet cherry): 110748081 Help Entry 110748081         CDS       T05161                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pavi  Prunus avium (sweet cherry) Pathway pavi03420   Nucleotide excision repair pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110748081    04120 Ubiquitin mediated proteolysis     110748081   09124 Replication and repair    03420 Nucleotide excision repair     110748081  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pavi04121]     110748081    03400 DNA repair and recombination proteins [BR:pavi03400]     110748081 Enzymes [BR:pavi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110748081 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110748081   Multi subunit type E3    SCF complex     Ring finger protein      110748081    Cul2 complex      110748081    Cul3 complex      110748081    Cul4 complex      110748081    Cul7 complex      110748081    Cul8 complex      110748081    Cul9 complex      110748081 DNA repair and recombination proteins [BR:pavi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110748081     TCR (transcription coupled repair) factors      Cul4-CSA complex       110748081 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 Motif Other DBs NCBI-GeneID:  110748081 NCBI-ProteinID:  XP_021803806 UniProt:  A0A6P5RRX5 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MATLDSDVPMVPVGEASSSAGSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGMLQLSVYA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggcgacattggattcagacgtgcctatggttccggtaggcgaggcttcaagcagtgca ggttcatcgaccaagaagcccaagcgatttgagatcaagaagtggaatgctgttgctctc tgggcctgggatattgttgttgataactgtgccatttgcaggaaccatatcatggatctc tgcattgagtgccaagcaaaccaggcaagcgccactagcgaggagtgtacagttgcttgg ggtatgcttcagctttcagtttatgcataa

DBGET integrated database retrieval system