Prunus avium (sweet cherry): 110769275 Help Entry 110769275         CDS       T05161                                  Name (RefSeq) RING-box protein 1a isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pavi  Prunus avium (sweet cherry) Pathway pavi03420   Nucleotide excision repair pavi04120   Ubiquitin mediated proteolysis pavi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pavi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110769275    04120 Ubiquitin mediated proteolysis     110769275   09124 Replication and repair    03420 Nucleotide excision repair     110769275  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pavi04121]     110769275    03400 DNA repair and recombination proteins [BR:pavi03400]     110769275 Enzymes [BR:pavi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110769275 Ubiquitin system [BR:pavi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110769275   Multi subunit type E3    SCF complex     Ring finger protein      110769275    Cul2 complex      110769275    Cul3 complex      110769275    Cul4 complex      110769275    Cul7 complex      110769275    Cul8 complex      110769275    Cul9 complex      110769275 DNA repair and recombination proteins [BR:pavi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110769275     TCR (transcription coupled repair) factors      Cul4-CSA complex       110769275 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  110769275 NCBI-ProteinID:  XP_021828911 UniProt:  A0A6P5TPE7 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MATLDSDVPMVPVGEASSSAGPLTKRPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggccacattggactctgacgtgccaatggttccggtaggcgaggcttcgagcagcgct ggtcctttgaccaagaggcccaagcggttcgagatcaagaagtggaatgctgtagctctc tgggcttgggatattgtggttgataactgtgccatttgcaggaaccatatcatggatctc tgcatcgagtgccaagcgaaccaggcaagtgccacaagtgaggagtgtacggttgcttgg ggggtctgtaaccatgcattccacttccattgcataagccgatggctgaaaacccgccaa gtgtgtccgttggataacagcgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system