Prionailurus bengalensis (leopard cat): 122471245 Help Entry 122471245         CDS       T07574                                  Symbol ACTB Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg03082   ATP-dependent chromatin remodeling pbg04015   Rap1 signaling pathway pbg04145   Phagosome pbg04210   Apoptosis pbg04390   Hippo signaling pathway pbg04510   Focal adhesion pbg04520   Adherens junction pbg04530   Tight junction pbg04611   Platelet activation pbg04613   Neutrophil extracellular trap formation pbg04670   Leukocyte transendothelial migration pbg04714   Thermogenesis pbg04810   Regulation of actin cytoskeleton pbg04814   Motor proteins pbg04820   Cytoskeleton in muscle cells pbg04919   Thyroid hormone signaling pathway pbg04921   Oxytocin signaling pathway pbg04971   Gastric acid secretion pbg05014   Amyotrophic lateral sclerosis pbg05100   Bacterial invasion of epithelial cells pbg05132   Salmonella infection pbg05135   Yersinia infection pbg05164   Influenza A pbg05205   Proteoglycans in cancer pbg05225   Hepatocellular carcinoma pbg05410   Hypertrophic cardiomyopathy pbg05412   Arrhythmogenic right ventricular cardiomyopathy pbg05414   Dilated cardiomyopathy pbg05416   Viral myocarditis pbg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     122471245 (ACTB)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     122471245 (ACTB)    04390 Hippo signaling pathway     122471245 (ACTB)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122471245 (ACTB)   09143 Cell growth and death    04210 Apoptosis     122471245 (ACTB)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122471245 (ACTB)    04520 Adherens junction     122471245 (ACTB)    04530 Tight junction     122471245 (ACTB)   09142 Cell motility    04814 Motor proteins     122471245 (ACTB)    04820 Cytoskeleton in muscle cells     122471245 (ACTB)    04810 Regulation of actin cytoskeleton     122471245 (ACTB)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     122471245 (ACTB)    04613 Neutrophil extracellular trap formation     122471245 (ACTB)    04670 Leukocyte transendothelial migration     122471245 (ACTB)   09152 Endocrine system    04921 Oxytocin signaling pathway     122471245 (ACTB)    04919 Thyroid hormone signaling pathway     122471245 (ACTB)   09154 Digestive system    04971 Gastric acid secretion     122471245 (ACTB)   09159 Environmental adaptation    04714 Thermogenesis     122471245 (ACTB)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     122471245 (ACTB)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     122471245 (ACTB)   09172 Infectious disease: viral    05164 Influenza A     122471245 (ACTB)   09171 Infectious disease: bacterial    05132 Salmonella infection     122471245 (ACTB)    05135 Yersinia infection     122471245 (ACTB)    05100 Bacterial invasion of epithelial cells     122471245 (ACTB)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     122471245 (ACTB)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     122471245 (ACTB)    05410 Hypertrophic cardiomyopathy     122471245 (ACTB)    05412 Arrhythmogenic right ventricular cardiomyopathy     122471245 (ACTB)    05414 Dilated cardiomyopathy     122471245 (ACTB)    05416 Viral myocarditis     122471245 (ACTB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pbg03021]     122471245 (ACTB)    03019 Messenger RNA biogenesis [BR:pbg03019]     122471245 (ACTB)    03036 Chromosome and associated proteins [BR:pbg03036]     122471245 (ACTB)    03029 Mitochondrial biogenesis [BR:pbg03029]     122471245 (ACTB)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pbg04812]     122471245 (ACTB)    04147 Exosome [BR:pbg04147]     122471245 (ACTB) Transcription machinery [BR:pbg03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      122471245 (ACTB) Messenger RNA biogenesis [BR:pbg03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      122471245 (ACTB) Chromosome and associated proteins [BR:pbg03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      122471245 (ACTB)     NuA4 complex      122471245 (ACTB)   Chromatin remodeling factors    BAF complex     122471245 (ACTB)    PBAF complex     122471245 (ACTB)    GBAF(ncBAF) complex     122471245 (ACTB)    SWR1 complex     122471245 (ACTB) Mitochondrial biogenesis [BR:pbg03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     122471245 (ACTB) Cytoskeleton proteins [BR:pbg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      122471245 (ACTB) Exosome [BR:pbg04147]  Exosomal proteins   Proteins found in most exosomes    122471245 (ACTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  122471245 NCBI-ProteinID:  XP_043415541 LinkDB All DBs Position E3:complement(4845717..4849516) Genome browser AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcaggcgacgatgccccacgggccgtcttcccttccatcgtggggcgcccccggcac cagggcgtgatggtgggtatgggccagaaggactcctatgtgggcgatgaggcccagagc aagaggggcatcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggac gacatggagaagatctggcatcacactttctacaatgagctgcgtgtggcccccgaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacc cacactgtgcccatctacgaggggtacgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc ttggacttcgagcaggagatggccaccgccgcgtcctcgtcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccccgaggcg ctcttccagccttccttcctgggcatggaatcctgtggtatccacgaaactaccttcaac tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct ggggggaccaccatgtaccccggcatcgctgaccggatgcagaaggagatcaccgccctg gcgcccagcacgatgaagatcaagatcatcgcaccccctgagcgcaagtactccgtgtgg atcggtggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag gagtatgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system