Prionailurus bengalensis (leopard cat): 122474874 Help Entry 122474874         CDS       T07574                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg04060   Cytokine-cytokine receptor interaction pbg04151   PI3K-Akt signaling pathway pbg04217   Necroptosis pbg04380   Osteoclast differentiation pbg04620   Toll-like receptor signaling pathway pbg04621   NOD-like receptor signaling pathway pbg04622   RIG-I-like receptor signaling pathway pbg04623   Cytosolic DNA-sensing pathway pbg04630   JAK-STAT signaling pathway pbg04650   Natural killer cell mediated cytotoxicity pbg04668   TNF signaling pathway pbg04936   Alcoholic liver disease pbg05135   Yersinia infection pbg05142   Chagas disease pbg05152   Tuberculosis pbg05160   Hepatitis C pbg05161   Hepatitis B pbg05162   Measles pbg05163   Human cytomegalovirus infection pbg05164   Influenza A pbg05165   Human papillomavirus infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05168   Herpes simplex virus 1 infection pbg05169   Epstein-Barr virus infection pbg05170   Human immunodeficiency virus 1 infection pbg05171   Coronavirus disease - COVID-19 pbg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     122474874 (IFNB1)    04668 TNF signaling pathway     122474874 (IFNB1)    04151 PI3K-Akt signaling pathway     122474874 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     122474874 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     122474874 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122474874 (IFNB1)    04621 NOD-like receptor signaling pathway     122474874 (IFNB1)    04622 RIG-I-like receptor signaling pathway     122474874 (IFNB1)    04623 Cytosolic DNA-sensing pathway     122474874 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     122474874 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     122474874 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     122474874 (IFNB1)    05161 Hepatitis B     122474874 (IFNB1)    05160 Hepatitis C     122474874 (IFNB1)    05171 Coronavirus disease - COVID-19     122474874 (IFNB1)    05164 Influenza A     122474874 (IFNB1)    05162 Measles     122474874 (IFNB1)    05168 Herpes simplex virus 1 infection     122474874 (IFNB1)    05163 Human cytomegalovirus infection     122474874 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     122474874 (IFNB1)    05169 Epstein-Barr virus infection     122474874 (IFNB1)    05165 Human papillomavirus infection     122474874 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     122474874 (IFNB1)    05152 Tuberculosis     122474874 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     122474874 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122474874 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122474874 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pbg04052]     122474874 (IFNB1) Cytokines and neuropeptides [BR:pbg04052]  Cytokines   Interferons    122474874 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  122474874 NCBI-ProteinID:  XP_043422137 LinkDB All DBs Position D4:complement(45587398..45588377) Genome browser AA seq 186 aa AA seqDB search MTARCILQIALLACFFTTAHSVSYKLLGFQLRSSSLECQELLLNLNRTSKYCLKDRMNFE VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRSTSSTGWNETTVENLLATLHWQKEHLE TILEEIMEEENFTWDNTTLLHLKRYYLRIVRYLKAKEYSVCAWTVVHAEILRNFFFLERL TDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccgccaggtgcatcctccaaatcgctctcttggcgtgtttcttcaccaccgcgcat tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag ctcctgctgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc aacgagatgttccagaagatctttaatattttcagtagaagcacctctagcacgggatgg aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg cacctgaagagatactacttaaggatcgtgcggtacctgaaggccaaggagtacagcgtc tgtgcctggacagtagtccacgcagaaatcctcaggaactttttcttccttgagagactt acagattatctccaaaactga

DBGET integrated database retrieval system