Prionailurus bengalensis (leopard cat): 122483868 Help Entry 122483868         CDS       T07574                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg00510   N-Glycan biosynthesis pbg00513   Various types of N-glycan biosynthesis pbg04141   Protein processing in endoplasmic reticulum Module pbg_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pbg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122483868 (TMEM258)    00513 Various types of N-glycan biosynthesis     122483868 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122483868 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  122483868 NCBI-ProteinID:  XP_043437303 LinkDB All DBs Position D1:complement(106203792..106206994) Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgctgttggccattggcatgttctttaccgcctggttcttcgtctatgag gtgacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcgcttttcatgggctttggagttctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system