Prionailurus bengalensis (leopard cat): 122488624 Help Entry 122488624         CDS       T07574                                  Symbol CD209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg03260   Virion - Human immunodeficiency virus pbg03264   Virion - Flavivirus and Alphavirus pbg03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus pbg03273   Virion - Lassa virus and SFTS virus pbg04145   Phagocytosis pbg04517   IgSF CAM signaling pbg04625   C-type lectin receptor signaling pathway pbg05152   Tuberculosis pbg05162   Measles Brite KEGG Orthology (KO) [BR:pbg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     122488624 (CD209)    03264 Virion - Flavivirus and Alphavirus     122488624 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     122488624 (CD209)    03273 Virion - Lassa virus and SFTS virus     122488624 (CD209)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122488624 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     122488624 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122488624 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     122488624 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     122488624 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pbg04131]     122488624 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:pbg04054]     122488624 (CD209)    04515 Cell adhesion molecules [BR:pbg04515]     122488624 (CD209)    04090 CD molecules [BR:pbg04090]     122488624 (CD209)    04091 Lectins [BR:pbg04091]     122488624 (CD209) Membrane trafficking [BR:pbg04131]  Endocytosis   Phagocytosis    C-lectin receptors     122488624 (CD209) Pattern recognition receptors [BR:pbg04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    122488624 (CD209) Cell adhesion molecules [BR:pbg04515]  Lectins   Selectins and C-type lectins    122488624 (CD209) CD molecules [BR:pbg04090]  Proteins   122488624 (CD209) Lectins [BR:pbg04091]  C-Type lectins   Asialoglycoprotein and DC receptors    122488624 (CD209) SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Peptidase_S15 PPI_helical UL45 Motif Other DBs NCBI-GeneID:  122488624 NCBI-ProteinID:  XP_043446138 LinkDB All DBs Position A2:6007515..6011049 Genome browser AA seq 254 aa AA seqDB search MAEMCDPKEPDDPEVEVFGNQRLAKKYTGLLRSSRSLPGCLTQAHLPLLLLLVSLGFFML LVTTLVQVSRIHQSLQRDTGDHRERNHQESPGLGDVSQTQKQSSLEEILQQLTWMNATLA GLCRHCPWKWELFQGSCYFFSLTQNTWKESIAACQNMRAQLVVINSTEEQKFLKSWNTKN SQRTWIGLSDHHNEGSWRWVDDTPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCSTEN FWICKKPSSPCPGL NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggcggagatgtgtgaccccaaggagccggatgaccccgaggtggaggtgtttgggaac cagagactggctaagaaatacaccggcctgctcaggagctcacggagcctgccaggatgt ctgacccaggcccacctgcctctgctgctgcttctcgtctctctgggcttcttcatgctc ctggtgaccactctggttcaagtctccaggatccaccaatccctgcagagagacacaggg gaccatcgggagaggaaccatcaggagagccccggcctcggggatgtttctcagacccag aaacaatcatccctggaggagatactccagcagctgacctggatgaatgccaccctggct ggcctgtgccgccactgcccctggaaatgggaacttttccagggaagctgctacttcttc tccctgacccagaacacctggaaagagtccatcgccgcgtgtcagaacatgagggcccag ctggtggtcatcaacagcactgaggagcagaaatttctgaagtcttggaatacgaaaaat agccagcgcacatggattggcctcagtgaccaccacaatgagggttcttggagatgggtg gacgacactcccctccaactcagcttctggaaagaaggggaacccaacaaccacggggat gaggactgtgtggaattgtacagtgacggctggaatgacaacagatgtagtacagaaaac ttctggatctgtaagaagccctcgtccccctgcccgggcctctga

DBGET integrated database retrieval system