Python bivittatus (Burmese python): 107326371 Help Entry 107326371         CDS       T03091                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pbi  Python bivittatus (Burmese python) Pathway pbi00510   N-Glycan biosynthesis pbi00513   Various types of N-glycan biosynthesis pbi04141   Protein processing in endoplasmic reticulum Module pbi_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pbi00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     107326371 (TMEM258)    00513 Various types of N-glycan biosynthesis     107326371 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107326371 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  107326371 NCBI-ProteinID:  XP_015745368 UniProt:  A0A9F3W0T6 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELETMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgagacaatgagcagatacactagtccggtgaatccggctgtgtttccacat ctcactgtggtgctcctggccattggcatgttcttcacagcttggttctttgtctatgaa gtgacatccaccaagtacacccgggatatttacaaagaactgctcatctctctagtagca tcactcttcatgggctttggagtactcttcttattgctgtgggttggaatctatgtgtga

DBGET integrated database retrieval system