KEGG   Paracoccidioides brasiliensis: PADG_05660
Entry
PADG_05660        CDS       T03549                                 
Name
(RefSeq) hypothetical protein
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
pbn  Paracoccidioides brasiliensis
Pathway
pbn00910  Nitrogen metabolism
pbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PADG_05660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pbn00199]
    PADG_05660
Enzymes [BR:pbn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     PADG_05660
Cytochrome P450 [BR:pbn00199]
 Cytochrome P450, fungi type
  CYP55 family
   PADG_05660
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 22584549
NCBI-ProteinID: XP_010760841
UniProt: C1GEH4
LinkDB
Position
Unknown
AA seq 439 aa
MTPARRYLRGSCGFCRSKSLNSARSGLAPRTQCFSMSTESSPPKFPFSRPSEAIPPLEYA
KLRATNPVSRVTLWDNSHPWLVVKHKDICSVLTDQRLSKQRTRPGFPEMNPGGKQAAKNR
PTFVDMDPPEHMHQRNMVASLFTRKNSETMRPHIKAIADILLDEMIQHGCENPVDLVEKF
ALPLPSYIIYGILGVPEHDLAYLTNCNAIRSNGSSTAAAAANANKELLDYIGNLVNKRLE
KPENDMISKLVVEQLKPGHIDRLDAVQIAFLMLVAGNATLVNMICLGVVTLLQNPSQLAD
LKANPSLAPQFVEELCRFHTASAMATRRVAKEDITLGGQLIKAGEGIIAATQSGNRDEEV
FPNPDVFDMYRKRGSETALGFGYGEHTCVAEWLARTEMEVVFATLFQRLPNLKLGIPQSE
IKYTPADQDVGITELPVVW
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgactccggcgagacgatatttaaggggctcatgcggattttgcagatctaaatcactt
aactctgctcgatcgggccttgctccacgcacccaatgcttcagcatgtctacagaatct
agccctccaaaattccctttctctcgcccatctgaggctataccccctcttgagtatgcg
aaactcagggccacaaatcccgtttctcgagttacactctgggacaacagtcacccatgg
cttgtggtcaaacataaggacatctgcagcgtccttactgatcaacgtttgtccaagcaa
cgcacccgcccaggtttccctgaaatgaatcctggagggaagcaagctgctaaaaaccgc
ccgactttcgttgatatggaccctcccgaacacatgcatcagaggaatatggttgcgtcc
cttttcaccaggaagaattctgagacaatgcgtccgcatattaaagccattgccgatatt
ctcctggatgaaatgatccaacacggctgtgaaaatcccgtagatttggttgagaagttt
gctctgcccctcccatcctatatcatatacggaattttaggggttccggagcatgacctt
gcgtatctcaccaattgtaatgctattcgcagtaatggaagttctaccgctgcagctgcg
gctaatgctaacaaggaactcctggattacatcggaaatttggtcaataaacgacttgaa
aaaccagagaatgacatgattagcaagttggttgtcgaacagcttaaaccggggcatatt
gacaggctagatgccgtccaaatcgcattcttgatgctggtcgctggaaatgcgacctta
gtcaacatgatttgtctcggcgtcgtaactcttctccagaacccgagtcaactggcagac
ctcaaagccaatccgtctctcgcgccccagtttgttgaggaactttgccgcttccacacg
gcttctgctatggccacaagacgagttgctaaagaggatatcacccttggtggccaactc
ataaaagcaggggaaggcataattgctgccacccaatccggcaaccgagatgaagaagtc
ttccccaacccagacgtcttcgatatgtaccgtaagaggggatctgagacggcccttggc
tttgggtatggcgaacacacttgtgtcgctgagtggttggctcgtactgagatggaagtt
gtttttgcaacgttgttccaacgacttccaaatctgaagcttgggatcccgcaatccgaa
atcaagtatacccccgcagatcaagacgttggcataactgagctcccagttgtctggtag

DBGET integrated database retrieval system