Physeter macrocephalus (sperm whale): 102973585 Help Entry 102973585         CDS       T06011                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04068   FoxO signaling pathway pcad04148   Efferocytosis pcad04625   C-type lectin receptor signaling pathway pcad04630   JAK-STAT signaling pathway pcad04660   T cell receptor signaling pathway pcad04672   Intestinal immune network for IgA production pcad05133   Pertussis pcad05135   Yersinia infection pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05143   African trypanosomiasis pcad05144   Malaria pcad05145   Toxoplasmosis pcad05146   Amoebiasis pcad05150   Staphylococcus aureus infection pcad05152   Tuberculosis pcad05310   Asthma pcad05320   Autoimmune thyroid disease pcad05321   Inflammatory bowel disease pcad05322   Systemic lupus erythematosus pcad05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102973585 (IL10)    04068 FoxO signaling pathway     102973585 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102973585 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     102973585 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102973585 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102973585 (IL10)    04660 T cell receptor signaling pathway     102973585 (IL10)    04672 Intestinal immune network for IgA production     102973585 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     102973585 (IL10)    05133 Pertussis     102973585 (IL10)    05150 Staphylococcus aureus infection     102973585 (IL10)    05152 Tuberculosis     102973585 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     102973585 (IL10)    05144 Malaria     102973585 (IL10)    05145 Toxoplasmosis     102973585 (IL10)    05140 Leishmaniasis     102973585 (IL10)    05142 Chagas disease     102973585 (IL10)    05143 African trypanosomiasis     102973585 (IL10)   09163 Immune disease    05310 Asthma     102973585 (IL10)    05322 Systemic lupus erythematosus     102973585 (IL10)    05320 Autoimmune thyroid disease     102973585 (IL10)    05321 Inflammatory bowel disease     102973585 (IL10)    05330 Allograft rejection     102973585 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102973585 (IL10)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102973585 (IL10) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Interleukins    102973585 (IL10) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Cytokines    102973585 (IL10) SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 Tyr_recomb_halo_N DUF8635 Motif Other DBs NCBI-GeneID:  102973585 NCBI-ProteinID:  XP_007100402 Ensembl:  ENSPCTG00005012787 UniProt:  A0A2Y9EEH6 LinkDB All DBs Position 4:38535355..38539903 Genome browser AA seq 178 aa AA seqDB search MPSSALLCCLIFLAGVAASQHQGTQSKDGCIHFPNSLPHMLRELRAAFSNVKTFFQMNDQ VDTSLLSQSLLEDFKGYLGCQALSEMIQFYLEEVMPQAEDHGPNIKEHVNSLGEKLKTLR LRLRRCHRFLPCENKSKAVEQVKSVFNKLQEKGVYKAMSEFDIFINYIEAYMTTKMKN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcccagctcagcactgctctgttgcctgatcttcctggccggggtggcagccagccaa caccagggcacccagtctaaggacggctgcatccacttcccaaacagcctgccccacatg ctccgggagctccgagctgccttcagcaacgtgaagactttctttcaaatgaatgaccag gtggacacctcgttgttgagccagtctctgctggaggactttaagggttacctgggttgc caagccttgtcggagatgatccagttttacctggaggaggtgatgccacaggctgaggac catggccccaacatcaaggagcatgtgaactccctgggggagaagctgaagaccctcagg ctgaggctgaggcgctgtcatcgatttctgccctgtgaaaacaagagcaaggcggtggag caggtgaagagcgtcttcaataagctccaagagaagggtgtctacaaagccatgagtgag tttgacatcttcatcaactacatagaagcctacatgacaacaaagatgaaaaactga

DBGET integrated database retrieval system