Physeter macrocephalus (sperm whale): 102979617
Help
Entry
102979617 CDS
T06011
Symbol
IL2RG
Name
(RefSeq) cytokine receptor common subunit gamma isoform X1
KO
K05070
interleukin 2 receptor gamma
Organism
pcad
Physeter macrocephalus (sperm whale)
Pathway
pcad04060
Cytokine-cytokine receptor interaction
pcad04061
Viral protein interaction with cytokine and cytokine receptor
pcad04144
Endocytosis
pcad04151
PI3K-Akt signaling pathway
pcad04630
JAK-STAT signaling pathway
pcad04658
Th1 and Th2 cell differentiation
pcad04659
Th17 cell differentiation
pcad05162
Measles
pcad05166
Human T-cell leukemia virus 1 infection
pcad05200
Pathways in cancer
pcad05321
Inflammatory bowel disease
pcad05340
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:
pcad00001
]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
102979617 (IL2RG)
04151 PI3K-Akt signaling pathway
102979617 (IL2RG)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
102979617 (IL2RG)
04061 Viral protein interaction with cytokine and cytokine receptor
102979617 (IL2RG)
09140 Cellular Processes
09141 Transport and catabolism
04144 Endocytosis
102979617 (IL2RG)
09150 Organismal Systems
09151 Immune system
04658 Th1 and Th2 cell differentiation
102979617 (IL2RG)
04659 Th17 cell differentiation
102979617 (IL2RG)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
102979617 (IL2RG)
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
102979617 (IL2RG)
05162 Measles
102979617 (IL2RG)
09163 Immune disease
05321 Inflammatory bowel disease
102979617 (IL2RG)
05340 Primary immunodeficiency
102979617 (IL2RG)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04050 Cytokine receptors [BR:
pcad04050
]
102979617 (IL2RG)
04090 CD molecules [BR:
pcad04090
]
102979617 (IL2RG)
Cytokine receptors [BR:
pcad04050
]
Interleukin receptor families
IL2 receptor family
102979617 (IL2RG)
CD molecules [BR:
pcad04090
]
Proteins
102979617 (IL2RG)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TSLPR_D1
CRLF2_D1
CRLF2-like_D2
IL6Ra-bind
fn3
EpoR_lig-bind
Interfer-bind
Motif
Other DBs
NCBI-GeneID:
102979617
NCBI-ProteinID:
XP_007114513
Ensembl:
ENSPCTG00005010021
UniProt:
A0A2Y9F3R3
LinkDB
All DBs
Position
21:complement(48719298..48722950)
Genome browser
AA seq
381 aa
AA seq
DB search
MLKPPLPLRSLLFLQLPLLGVGLNSKVLTPNGNEDITAGGKPGTGGDFFLTSTPAGTLNV
STLPLPKVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYGYKNFNDDDKLQECGHYLFSEGI
TSGCWFGKKEIHLYQTFVVQLQDPWEHRRQPEQLLKLQDLVIPWAPENLTLRNLSEFQLE
LSWSNRHLDHCLEHLVQYRSNRDHSWTEQAVDHRHSFSLPSVDAQKLYTFRVRSRYNPLC
GSAQHWSDWSCPIHWGSNTSKEDPENPETPSLFALKAVLIPVVSMALIVSLICLYWRLER
TMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGEGPGG
SPCSQHSPYWAPPCYTLKPEP
NT seq
1146 nt
NT seq
+upstream
nt +downstream
nt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaactcaaaggtcctcacgcccaatgggaatgaagacatcacagctggtggg
aaacctgggactggaggagacttcttcctgacctctacacccgctgggaccctcaatgtt
tccactctgcccctcccaaaggttcagtgttttgtgttcaatgtcgagtacatgaattgc
acctggaacagcagctctgagccccagcctaccaacctgactctgcattatgggtacaag
aactttaatgatgatgataaactccaggagtgtggccactatctcttctctgaagggatc
acttctggctgttggtttggaaaaaaggagatccatctctaccaaacatttgttgtccag
ctccaggacccatgggaacacaggaggcagcccgaacagttgctaaaactgcaggatctg
gtgatcccctgggctccggagaatctgacacttcgcaacctgagtgaattccagctagaa
ctgagttggagcaacagacacttggaccactgtttggagcacctggtgcagtaccggagt
aaccgggaccacagctggactgaacaagccgtggaccacagacatagcttctctctgcct
agcgtggatgcacagaaactctacacgttccgtgttcgaagccgctataacccactctgt
ggaagcgctcagcattggagtgactggagctgccccatccactggggcagcaatacttca
aaggaggatcctgagaatcctgagactccttcgttgtttgcattgaaagctgtgctgatc
cccgttgtctccatggcattgatcgtgagcctcatctgtttgtactggaggctggaacgg
acgatgccccgaattcctaccctcaagaacctagaggatctggttactgaataccacggg
aacttttcggcctggagtggtgtgtctaagggactggcagaaagtctgcagccagactac
agtgaacggctctgccacgtcagtgagatcccccccaaaggaggggaagggcctgggggc
tccccctgcagccagcatagcccctactgggctcctccatgttacaccctgaaacctgag
ccctga
DBGET
integrated database retrieval system