Physeter macrocephalus (sperm whale): 102981551 Help Entry 102981551         CDS       T06011                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03050   Proteasome pcad04060   Cytokine-cytokine receptor interaction pcad04066   HIF-1 signaling pathway pcad04217   Necroptosis pcad04350   TGF-beta signaling pathway pcad04380   Osteoclast differentiation pcad04612   Antigen processing and presentation pcad04630   JAK-STAT signaling pathway pcad04650   Natural killer cell mediated cytotoxicity pcad04657   IL-17 signaling pathway pcad04658   Th1 and Th2 cell differentiation pcad04659   Th17 cell differentiation pcad04660   T cell receptor signaling pathway pcad04940   Type I diabetes mellitus pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05143   African trypanosomiasis pcad05144   Malaria pcad05145   Toxoplasmosis pcad05146   Amoebiasis pcad05152   Tuberculosis pcad05160   Hepatitis C pcad05164   Influenza A pcad05168   Herpes simplex virus 1 infection pcad05200   Pathways in cancer pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05321   Inflammatory bowel disease pcad05322   Systemic lupus erythematosus pcad05323   Rheumatoid arthritis pcad05330   Allograft rejection pcad05332   Graft-versus-host disease pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     102981551 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     102981551 (IFNG)    04630 JAK-STAT signaling pathway     102981551 (IFNG)    04066 HIF-1 signaling pathway     102981551 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102981551 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102981551 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     102981551 (IFNG)    04612 Antigen processing and presentation     102981551 (IFNG)    04660 T cell receptor signaling pathway     102981551 (IFNG)    04658 Th1 and Th2 cell differentiation     102981551 (IFNG)    04659 Th17 cell differentiation     102981551 (IFNG)    04657 IL-17 signaling pathway     102981551 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     102981551 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102981551 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102981551 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     102981551 (IFNG)    05164 Influenza A     102981551 (IFNG)    05168 Herpes simplex virus 1 infection     102981551 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     102981551 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     102981551 (IFNG)    05144 Malaria     102981551 (IFNG)    05145 Toxoplasmosis     102981551 (IFNG)    05140 Leishmaniasis     102981551 (IFNG)    05142 Chagas disease     102981551 (IFNG)    05143 African trypanosomiasis     102981551 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     102981551 (IFNG)    05323 Rheumatoid arthritis     102981551 (IFNG)    05321 Inflammatory bowel disease     102981551 (IFNG)    05330 Allograft rejection     102981551 (IFNG)    05332 Graft-versus-host disease     102981551 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102981551 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102981551 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pcad03051]     102981551 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102981551 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102981551 (IFNG) Proteasome [BR:pcad03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     102981551 (IFNG) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Interferons    102981551 (IFNG) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Cytokines    102981551 (IFNG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma API5 PRANC rva_4 Motif Other DBs NCBI-GeneID:  102981551 NCBI-ProteinID:  XP_007106317 Ensembl:  ENSPCTG00005002990 UniProt:  A0A2Y9EPI7 LinkDB All DBs Position 6:complement(4638590..4643072) Genome browser AA seq 166 aa AA seqDB search MKYTSYFLAFQLCVILGSSGSYCQAPFFKEIENLKEYFNASNPDVAEGGPLFLEILKNWK DESDKKIIQSQIVSFYFKLFESLKDNQIIQRSMDIIKQDIFQKFLNGSSEKLDNFKKLIQ IPVDDLQIQRKAISELIRVMNDLSPRSNLRKRRRSQNLFRGQRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaatataccagttatttcttagcttttcagctgtgcgtgattttgggttcttctggc tcttactgccaggccccattttttaaagaaatagaaaacctaaaggaatattttaatgca agtaacccagatgtagctgagggtgggcctcttttcttagaaattttgaagaattggaaa gatgagagtgacaaaaaaataattcagagccaaatcgtctccttctacttcaaactcttt gaaagcttaaaagataaccagatcattcaaaggagcatggatatcatcaagcaggacata tttcagaagttcttaaatggcagctctgagaaactggataacttcaaaaagctgattcaa attccggtagatgatctgcagatccaacgcaaagccataagtgaactcatcagagtgatg aatgacctgtcgccaagatctaacctcagaaagcggaggagaagtcagaatctgtttcga ggccagagagcatcgaaataa

DBGET integrated database retrieval system