Physeter macrocephalus (sperm whale): 102982453 Help Entry 102982453         CDS       T06011                                  Symbol FOS Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad01522   Endocrine resistance pcad04010   MAPK signaling pathway pcad04024   cAMP signaling pathway pcad04210   Apoptosis pcad04380   Osteoclast differentiation pcad04620   Toll-like receptor signaling pathway pcad04657   IL-17 signaling pathway pcad04658   Th1 and Th2 cell differentiation pcad04659   Th17 cell differentiation pcad04660   T cell receptor signaling pathway pcad04662   B cell receptor signaling pathway pcad04668   TNF signaling pathway pcad04713   Circadian entrainment pcad04725   Cholinergic synapse pcad04728   Dopaminergic synapse pcad04915   Estrogen signaling pathway pcad04917   Prolactin signaling pathway pcad04921   Oxytocin signaling pathway pcad04926   Relaxin signaling pathway pcad04928   Parathyroid hormone synthesis, secretion and action pcad04932   Non-alcoholic fatty liver disease pcad04935   Growth hormone synthesis, secretion and action pcad05031   Amphetamine addiction pcad05132   Salmonella infection pcad05133   Pertussis pcad05135   Yersinia infection pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05161   Hepatitis B pcad05162   Measles pcad05166   Human T-cell leukemia virus 1 infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05170   Human immunodeficiency virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05200   Pathways in cancer pcad05207   Chemical carcinogenesis - receptor activation pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05210   Colorectal cancer pcad05224   Breast cancer pcad05231   Choline metabolism in cancer pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05323   Rheumatoid arthritis pcad05417   Lipid and atherosclerosis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102982453 (FOS)    04668 TNF signaling pathway     102982453 (FOS)    04024 cAMP signaling pathway     102982453 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102982453 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102982453 (FOS)    04660 T cell receptor signaling pathway     102982453 (FOS)    04658 Th1 and Th2 cell differentiation     102982453 (FOS)    04659 Th17 cell differentiation     102982453 (FOS)    04657 IL-17 signaling pathway     102982453 (FOS)    04662 B cell receptor signaling pathway     102982453 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     102982453 (FOS)    04917 Prolactin signaling pathway     102982453 (FOS)    04921 Oxytocin signaling pathway     102982453 (FOS)    04926 Relaxin signaling pathway     102982453 (FOS)    04935 Growth hormone synthesis, secretion and action     102982453 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     102982453 (FOS)   09156 Nervous system    04725 Cholinergic synapse     102982453 (FOS)    04728 Dopaminergic synapse     102982453 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     102982453 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     102982453 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102982453 (FOS)    05207 Chemical carcinogenesis - receptor activation     102982453 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     102982453 (FOS)    05231 Choline metabolism in cancer     102982453 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102982453 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     102982453 (FOS)    05224 Breast cancer     102982453 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102982453 (FOS)    05170 Human immunodeficiency virus 1 infection     102982453 (FOS)    05161 Hepatitis B     102982453 (FOS)    05171 Coronavirus disease - COVID-19     102982453 (FOS)    05162 Measles     102982453 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     102982453 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102982453 (FOS)    05135 Yersinia infection     102982453 (FOS)    05133 Pertussis     102982453 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102982453 (FOS)    05142 Chagas disease     102982453 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     102982453 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     102982453 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102982453 (FOS)    05418 Fluid shear stress and atherosclerosis     102982453 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102982453 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102982453 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcad03000]     102982453 (FOS)    04131 Membrane trafficking [BR:pcad04131]     102982453 (FOS) Transcription factors [BR:pcad03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     102982453 (FOS) Membrane trafficking [BR:pcad04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102982453 (FOS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  102982453 NCBI-ProteinID:  XP_007117188 Ensembl:  ENSPCTG00005018202 UniProt:  A0A2Y9F8G1 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGPYSRTGVMKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDVGFPEEMSVASLDLSGVLPEAATPESEDAFT LPLLNDPEPKPSVEPVKSMSNMELKAEPFDDFLFPASSRPSASETARSVPDMDLSGSFYA ADWEPLHGSSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcatcctcccgctgcagcagcgcc tccccggccggggacagcctctcctactaccactcaccggccgactccttctccagtatg ggctctcccgtcaatgcgcaggacttctgcaccgatctggccgtctccagtgccaacttc atcccaacagtgaccgccatctcgaccagcccggacctgcagtggctagtgcagcccacc ctggtctcctccgtggccccatcccagaccagagccccccacccctatggagtccccacc ccctcggctgggccttactccaggactggagtcatgaagaccatgaccggaggcagagct cagagcattggcaggaggggcaaggtggaacagttgtccccagaagaagaggagaagagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagggag ctgactgacacactccaagcggaaacagaccaactagaagatgagaagtctgctttgcag actgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac cgacctgcctgcaagatccctgatgacgtgggcttcccagaagaaatgtctgtggcttcc cttgatctgagcggggtcctgcctgaagctgccacccccgaatctgaggatgccttcacc ctacccctccttaatgaccctgagcccaagccctcggtggagcccgtcaagagcatgagc aacatggagctgaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agcgcctctgagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtagctccctggggatggggcccatggccacagagctg gaacccctgtgcaccccggtggtcacctgtacgcccagctgcactacttacacgtcttcc ttcgtcttcacctaccctgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system