Physeter macrocephalus (sperm whale): 102983069 Help Entry 102983069         CDS       T06011                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad01523   Antifolate resistance pcad04010   MAPK signaling pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04064   NF-kappa B signaling pathway pcad04071   Sphingolipid signaling pathway pcad04150   mTOR signaling pathway pcad04210   Apoptosis pcad04217   Necroptosis pcad04350   TGF-beta signaling pathway pcad04380   Osteoclast differentiation pcad04612   Antigen processing and presentation pcad04620   Toll-like receptor signaling pathway pcad04621   NOD-like receptor signaling pathway pcad04622   RIG-I-like receptor signaling pathway pcad04625   C-type lectin receptor signaling pathway pcad04640   Hematopoietic cell lineage pcad04650   Natural killer cell mediated cytotoxicity pcad04657   IL-17 signaling pathway pcad04660   T cell receptor signaling pathway pcad04664   Fc epsilon RI signaling pathway pcad04668   TNF signaling pathway pcad04920   Adipocytokine signaling pathway pcad04930   Type II diabetes mellitus pcad04931   Insulin resistance pcad04932   Non-alcoholic fatty liver disease pcad04933   AGE-RAGE signaling pathway in diabetic complications pcad04936   Alcoholic liver disease pcad04940   Type I diabetes mellitus pcad05010   Alzheimer disease pcad05014   Amyotrophic lateral sclerosis pcad05020   Prion disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05132   Salmonella infection pcad05133   Pertussis pcad05134   Legionellosis pcad05135   Yersinia infection pcad05140   Leishmaniasis pcad05142   Chagas disease pcad05143   African trypanosomiasis pcad05144   Malaria pcad05145   Toxoplasmosis pcad05146   Amoebiasis pcad05152   Tuberculosis pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05163   Human cytomegalovirus infection pcad05164   Influenza A pcad05165   Human papillomavirus infection pcad05166   Human T-cell leukemia virus 1 infection pcad05168   Herpes simplex virus 1 infection pcad05169   Epstein-Barr virus infection pcad05170   Human immunodeficiency virus 1 infection pcad05171   Coronavirus disease - COVID-19 pcad05205   Proteoglycans in cancer pcad05310   Asthma pcad05321   Inflammatory bowel disease pcad05322   Systemic lupus erythematosus pcad05323   Rheumatoid arthritis pcad05330   Allograft rejection pcad05332   Graft-versus-host disease pcad05410   Hypertrophic cardiomyopathy pcad05414   Dilated cardiomyopathy pcad05417   Lipid and atherosclerosis pcad05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102983069 (TNF)    04350 TGF-beta signaling pathway     102983069 (TNF)    04064 NF-kappa B signaling pathway     102983069 (TNF)    04668 TNF signaling pathway     102983069 (TNF)    04071 Sphingolipid signaling pathway     102983069 (TNF)    04150 mTOR signaling pathway     102983069 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102983069 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     102983069 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102983069 (TNF)    04217 Necroptosis     102983069 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102983069 (TNF)    04620 Toll-like receptor signaling pathway     102983069 (TNF)    04621 NOD-like receptor signaling pathway     102983069 (TNF)    04622 RIG-I-like receptor signaling pathway     102983069 (TNF)    04625 C-type lectin receptor signaling pathway     102983069 (TNF)    04650 Natural killer cell mediated cytotoxicity     102983069 (TNF)    04612 Antigen processing and presentation     102983069 (TNF)    04660 T cell receptor signaling pathway     102983069 (TNF)    04657 IL-17 signaling pathway     102983069 (TNF)    04664 Fc epsilon RI signaling pathway     102983069 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102983069 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     102983069 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102983069 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102983069 (TNF)    05170 Human immunodeficiency virus 1 infection     102983069 (TNF)    05161 Hepatitis B     102983069 (TNF)    05160 Hepatitis C     102983069 (TNF)    05171 Coronavirus disease - COVID-19     102983069 (TNF)    05164 Influenza A     102983069 (TNF)    05168 Herpes simplex virus 1 infection     102983069 (TNF)    05163 Human cytomegalovirus infection     102983069 (TNF)    05169 Epstein-Barr virus infection     102983069 (TNF)    05165 Human papillomavirus infection     102983069 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     102983069 (TNF)    05135 Yersinia infection     102983069 (TNF)    05133 Pertussis     102983069 (TNF)    05134 Legionellosis     102983069 (TNF)    05152 Tuberculosis     102983069 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     102983069 (TNF)    05144 Malaria     102983069 (TNF)    05145 Toxoplasmosis     102983069 (TNF)    05140 Leishmaniasis     102983069 (TNF)    05142 Chagas disease     102983069 (TNF)    05143 African trypanosomiasis     102983069 (TNF)   09163 Immune disease    05310 Asthma     102983069 (TNF)    05322 Systemic lupus erythematosus     102983069 (TNF)    05323 Rheumatoid arthritis     102983069 (TNF)    05321 Inflammatory bowel disease     102983069 (TNF)    05330 Allograft rejection     102983069 (TNF)    05332 Graft-versus-host disease     102983069 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     102983069 (TNF)    05014 Amyotrophic lateral sclerosis     102983069 (TNF)    05020 Prion disease     102983069 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     102983069 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102983069 (TNF)    05418 Fluid shear stress and atherosclerosis     102983069 (TNF)    05410 Hypertrophic cardiomyopathy     102983069 (TNF)    05414 Dilated cardiomyopathy     102983069 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102983069 (TNF)    04940 Type I diabetes mellitus     102983069 (TNF)    04936 Alcoholic liver disease     102983069 (TNF)    04932 Non-alcoholic fatty liver disease     102983069 (TNF)    04931 Insulin resistance     102983069 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     102983069 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102983069 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102983069 (TNF)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102983069 (TNF) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Tumor necrosis fators    102983069 (TNF) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Cytokines    102983069 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  102983069 NCBI-ProteinID:  XP_007110219 Ensembl:  ENSPCTG00005013376 UniProt:  A0A2Y9EW81 LinkDB All DBs Position 18:complement(85181256..85184050) Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALSKTAGDSQGSRRCLCLSLFSFFLVAGATMLFCLLHFGVIGPQR EEFPTGYSIISPLAQTLRSSSKTSSNKPVAHVVANLSAQGQLRWLNTYANTLLANSVKLE DNQLVVPTDGLYLIYSQVLFRGQGCPPTHLFLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggatgtggagctggcagaggaggcgctctccaagacg gccggggactcccagggttccagaaggtgcttgtgtctcagcctcttctccttcttcctg gtcgcaggagccaccatgctcttctgcctgctgcacttcggggtaatcggcccccagagg gaagagttcccaactggctactccatcatcagccctctggctcagacactcagatcatct tctaaaacctcaagtaacaagcccgtagcccatgttgtagccaacctcagtgctcagggg cagctccggtggctgaacacatatgccaacaccctcctggccaacagcgtgaagctggaa gacaaccagctggtggtgccgacagacgggctgtacctcatctactcccaggtcctcttc aggggccaaggctgccctcccacccacttgttcctcacccacaccatcagccgcatcgct gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccagagggag acgccagagggggctgaggccaagccctggtatgagcccatctaccagggaggggtcttc cagctggagaagggtgatcgactcagtgctgagatcaacctgcccgactatctggacttt gctgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system