Physeter macrocephalus (sperm whale): 102989017 Help Entry 102989017         CDS       T06011                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad01521   EGFR tyrosine kinase inhibitor resistance pcad04010   MAPK signaling pathway pcad04014   Ras signaling pathway pcad04015   Rap1 signaling pathway pcad04020   Calcium signaling pathway pcad04151   PI3K-Akt signaling pathway pcad04550   Signaling pathways regulating pluripotency of stem cells pcad04810   Regulation of actin cytoskeleton pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05200   Pathways in cancer pcad05205   Proteoglycans in cancer pcad05207   Chemical carcinogenesis - receptor activation pcad05218   Melanoma pcad05224   Breast cancer pcad05226   Gastric cancer Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102989017 (FGF2)    04014 Ras signaling pathway     102989017 (FGF2)    04015 Rap1 signaling pathway     102989017 (FGF2)    04020 Calcium signaling pathway     102989017 (FGF2)    04151 PI3K-Akt signaling pathway     102989017 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102989017 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102989017 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102989017 (FGF2)    05205 Proteoglycans in cancer     102989017 (FGF2)    05207 Chemical carcinogenesis - receptor activation     102989017 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     102989017 (FGF2)    05218 Melanoma     102989017 (FGF2)    05224 Breast cancer     102989017 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     102989017 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102989017 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102989017 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102989017 (FGF2) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Growth factors (RTK binding)    102989017 (FGF2) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Growth factors/receptors    102989017 (FGF2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FGF Fascin IL1 Motif Other DBs NCBI-GeneID:  102989017 NCBI-ProteinID:  XP_007116207 UniProt:  A0A2Y9F7B8 LinkDB All DBs Position 7:126469208..126524801 Genome browser AA seq 155 aa AA seqDB search MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgcc ttcccgcccggccacttcaaggaccccaagcggctgtactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgcgagaagagcgaccctcacatc aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac cgttaccttgctatgaaggaagatggaagattactggcttctaaatgtgttacagacgag tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac tccagttggtatgtggcactgaaacgaactgggcagtataaacttggacccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system