Physeter macrocephalus (sperm whale): 102989809 Help Entry 102989809         CDS       T06011                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad00510   N-Glycan biosynthesis pcad00513   Various types of N-glycan biosynthesis pcad04141   Protein processing in endoplasmic reticulum Module pcad_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:pcad00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     102989809 (TMEM258)    00513 Various types of N-glycan biosynthesis     102989809 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102989809 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  102989809 NCBI-ProteinID:  XP_007106255 Ensembl:  ENSPCTG00005008491 UniProt:  A0A2Y9EQE9 LinkDB All DBs Position 16:100821376..100825482 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagtccagtgaacccggctgtctttccgcat ctgaccgtggtgctgttggccattggcatgttcttcaccgcctggttcttcgtttatgag gtcacctccaccaaatacactcgcgatatctacaaagagctcctcatctctttggtggcc tcactcttcatgggcttcggcgtgctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system