Physeter macrocephalus (sperm whale): 102989857 Help Entry 102989857         CDS       T06011                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad03083   Polycomb repressive complex pcad04010   MAPK signaling pathway pcad05200   Pathways in cancer pcad05202   Transcriptional misregulation in cancer pcad05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:pcad00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     102989857 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102989857 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102989857 (MAX)    05202 Transcriptional misregulation in cancer     102989857 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     102989857 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcad03000]     102989857 (MAX)    03036 Chromosome and associated proteins [BR:pcad03036]     102989857 (MAX) Transcription factors [BR:pcad03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     102989857 (MAX) Chromosome and associated proteins [BR:pcad03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      102989857 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  102989857 NCBI-ProteinID:  XP_007116421 Ensembl:  ENSPCTG00005012734 UniProt:  A0A2Y9F751 LinkDB All DBs Position 11:complement(146209123..146233104) Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcagactcc agctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system