Physeter macrocephalus (sperm whale): 102990097 Help Entry 102990097         CDS       T06011                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism pcad  Physeter macrocephalus (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway pcad04064   NF-kappa B signaling pathway pcad04360   Axon guidance pcad04670   Leukocyte transendothelial migration pcad04672   Intestinal immune network for IgA production pcad04810   Regulation of actin cytoskeleton pcad05163   Human cytomegalovirus infection pcad05200   Pathways in cancer pcad05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102990097 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102990097 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     102990097 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102990097 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102990097 (CXCL12)    04672 Intestinal immune network for IgA production     102990097 (CXCL12)    04062 Chemokine signaling pathway     102990097 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     102990097 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102990097 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102990097 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     102990097 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102990097 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:pcad00536]     102990097 (CXCL12) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102990097 (CXCL12) Glycosaminoglycan binding proteins [BR:pcad00536]  Heparan sulfate / Heparin   Chemokines    102990097 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102990097 NCBI-ProteinID:  XP_028342466 Ensembl:  ENSPCTG00005011432 UniProt:  A0A455BET3 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MDAKIVAVLALVLAALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatgccaagatcgtcgctgtgctggccctcgtgctggctgcgctgtgcctcagcgac gggaaaccagtcagcctgagctacagatgcccttgccgattctttgagagccacgtcgcc agagccaatgtcaagcatctcaaaatcctgaacactccaaattgtgcccttcagatcgtg gcaaggctgaagaacaacaatagacaagtgtgcatcgacccgaaattgaagtggattcag gaatacctggagaaagctttaaacaagtaa

DBGET integrated database retrieval system