Phalacrocorax carbo (great cormorant): 104042802 Help Entry 104042802         CDS       T08596                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pcao  Phalacrocorax carbo (great cormorant) Pathway pcao00670   One carbon pool by folate pcao00790   Folate biosynthesis pcao01100   Metabolic pathways pcao01240   Biosynthesis of cofactors pcao04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:pcao00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104042802 (DHFR)    00670 One carbon pool by folate     104042802 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104042802 (DHFR) Enzymes [BR:pcao01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104042802 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104042802 NCBI-ProteinID:  XP_009500602 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTSHVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILQEFESDTFFPEIDYKDY KLITEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactagcacatcccacgtagaaggtaaacagaatgccctgataatgggtaaaaaaacc tggttctccattcctgagaagaaccgtcctttaaaagacagaattaatatagtgctcagc agggagctcaaggaaaccccaaaaggagcacattatctttccaaaagcctggatgatgct ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtttggatcgtcgga ggcacttcagtttacaaggcagcaatggagaagccaattaatcatcgattgtttgtgaca agaattttgcaggaatttgaaagtgacacattttttccagaaattgattacaaagactac aaacttatcactgaatacccaggtgtccctgctgatatccaagaagagaatggcatccag tacaaatttgaggtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system