Proteus terrae subsp. cibarius: F9282_15570 Help Entry F9282_15570       CDS       T06330                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pcib  Proteus terrae subsp. cibarius Pathway pcib00670   One carbon pool by folate pcib00790   Folate biosynthesis pcib01100   Metabolic pathways pcib01240   Biosynthesis of cofactors pcib04981   Folate transport and metabolism Module pcib_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:pcib00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     F9282_15570 (folA)    00670 One carbon pool by folate     F9282_15570 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     F9282_15570 (folA) Enzymes [BR:pcib01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      F9282_15570 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QGW04318 LinkDB All DBs Position complement(3298256..3298741) Genome browser AA seq 161 aa AA seqDB search MNISLIAALAMDRIIGMEKAMPWTLPGDLAWFKKNTLNKPVIMGRVTYESIGRPLPNRLN IVLSSQPGTDSDVVWVKSVEEALQAAENHEEIMVIGGGKVYEQFLPMANTLYLTHIDAEV IGDTTFPDYEPDEWDSTFMEYHEADENNSHNYCFEILKRRK NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgaatattagtttaatcgcagcattagcgatggatcgcattattggtatggaaaaggca atgccttggacattaccgggtgacctcgcatggtttaaaaagaatacgctaaataaaccc gttattatgggccgggtgacttatgagtctattggacgtcctttaccgaatcgtctgaat attgttttaagtagccaaccgggaacagatagcgatgttgtttgggttaaatctgtagag gaagctttacaagctgctgaaaatcatgaagaaatcatggtgataggtggcggtaaagtg tatgagcaatttcttcctatggcaaatacactttacctaactcacattgacgctgaagtt atcggtgatacaacattcccagattatgagcctgatgagtgggattcaacctttatggaa taccatgaagcagatgaaaataactcacataactactgcttcgaaatattaaaaagaaga aaataa

DBGET integrated database retrieval system