Phanerochaete carnosa: PHACADRAFT_253837 Help Entry PHACADRAFT_253837 CDS       T03128                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pco  Phanerochaete carnosa Pathway pco03420   Nucleotide excision repair pco04111   Cell cycle - yeast pco04120   Ubiquitin mediated proteolysis pco04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PHACADRAFT_253837    04120 Ubiquitin mediated proteolysis     PHACADRAFT_253837   09124 Replication and repair    03420 Nucleotide excision repair     PHACADRAFT_253837  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     PHACADRAFT_253837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pco04121]     PHACADRAFT_253837    03400 DNA repair and recombination proteins [BR:pco03400]     PHACADRAFT_253837 Enzymes [BR:pco01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PHACADRAFT_253837 Ubiquitin system [BR:pco04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PHACADRAFT_253837   Multi subunit type E3    SCF complex     Ring finger protein      PHACADRAFT_253837    Cul2 complex      PHACADRAFT_253837    Cul3 complex      PHACADRAFT_253837    Cul4 complex      PHACADRAFT_253837    Cul7 complex      PHACADRAFT_253837    Cul8 complex      PHACADRAFT_253837    Cul9 complex      PHACADRAFT_253837 DNA repair and recombination proteins [BR:pco03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PHACADRAFT_253837     TCR (transcription coupled repair) factors      Cul4-CSA complex       PHACADRAFT_253837 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_16 Motif Other DBs NCBI-GeneID:  18915894 NCBI-ProteinID:  XP_007394466 JGI:  Phaca1_253837 UniProt:  K5WC89 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MADMDVDVPDEIEPKVKGKAGEDSKGGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQVSATNDECNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctgacatggatgttgatgtccccgacgagattgagcccaaggtcaagggaaaggcc ggcgaggacagcaagggcggcaagaagcgattcgaggtcaagaagtggaacgctgtagcg ttatgggcatgggatatcgtcgtcgacaactgcgccatctgcaggaatcacatcatggac ctctgtattgagtgccaagcgaaccaggtatccgccactaacgacgagtgtaatgccgca tgggggatttgtaatcacgcctttcacttccattgcatctctcgatggctcaaaacccgt aacgtatgtcctctggacaatcgggagtgggagctgcagaaatacggccgatag

DBGET integrated database retrieval system