Puma concolor (puma): 112849621 Help Entry 112849621         CDS       T08890                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04151   PI3K-Akt signaling pathway pcoo04217   Necroptosis pcoo04380   Osteoclast differentiation pcoo04620   Toll-like receptor signaling pathway pcoo04621   NOD-like receptor signaling pathway pcoo04622   RIG-I-like receptor signaling pathway pcoo04623   Cytosolic DNA-sensing pathway pcoo04630   JAK-STAT signaling pathway pcoo04650   Natural killer cell mediated cytotoxicity pcoo04668   TNF signaling pathway pcoo04936   Alcoholic liver disease pcoo05135   Yersinia infection pcoo05142   Chagas disease pcoo05152   Tuberculosis pcoo05160   Hepatitis C pcoo05161   Hepatitis B pcoo05162   Measles pcoo05163   Human cytomegalovirus infection pcoo05164   Influenza A pcoo05165   Human papillomavirus infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05168   Herpes simplex virus 1 infection pcoo05169   Epstein-Barr virus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112849621 (IFNB1)    04668 TNF signaling pathway     112849621 (IFNB1)    04151 PI3K-Akt signaling pathway     112849621 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112849621 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112849621 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112849621 (IFNB1)    04621 NOD-like receptor signaling pathway     112849621 (IFNB1)    04622 RIG-I-like receptor signaling pathway     112849621 (IFNB1)    04623 Cytosolic DNA-sensing pathway     112849621 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     112849621 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     112849621 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112849621 (IFNB1)    05161 Hepatitis B     112849621 (IFNB1)    05160 Hepatitis C     112849621 (IFNB1)    05171 Coronavirus disease - COVID-19     112849621 (IFNB1)    05164 Influenza A     112849621 (IFNB1)    05162 Measles     112849621 (IFNB1)    05168 Herpes simplex virus 1 infection     112849621 (IFNB1)    05163 Human cytomegalovirus infection     112849621 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     112849621 (IFNB1)    05169 Epstein-Barr virus infection     112849621 (IFNB1)    05165 Human papillomavirus infection     112849621 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     112849621 (IFNB1)    05152 Tuberculosis     112849621 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     112849621 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112849621 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112849621 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112849621 (IFNB1) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interferons    112849621 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112849621 NCBI-ProteinID:  XP_025769092 UniProt:  A0A6P6H087 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTGRCILQIALLVCFFTTAHSVSYKLLGFQLRSSSLECQELLVNLNRTSKYCLKDRMNFE VPEEIKKSQRFQKEEAILVINEMFQKIFNIFSRSTSSTGWNETTVENLLATLHWQKEHLE TILEEIMEEENFTWDNTTLLHLKKYYLRIVRYLKAKEYSVCAWTVVHAEILRNFFFLERL IDYLQN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccggcaggtgcatcctccaaatcgctctcttggtgtgtttcttcaccaccgcgcat tccgtgagctacaagttgcttggattccaactaagaagcagcagtttggagtgtcaggag ctcctggtgaacttgaacagaacctctaaatattgcctcaaggacaggatgaacttcgag gtccctgaggagattaaaaaatcacagcggttccagaaggaggaagccatattggtcatc aacgagatgttccagaagatctttaatattttcagtagaagcacctctagcacgggatgg aatgagaccactgttgagaacctccttgcgacactccactggcagaaggaacacctggaa acgatcctggaggaaatcatggaggaggaaaacttcacctgggacaatacgacccttctg cacctgaagaaatactacttaaggatcgtgcggtacctgaaggccaaggagtacagcgtc tgtgcctggacagtagtccacgcagaaatcctcaggaactttttcttccttgagagactt atagattatctccaaaactga

DBGET integrated database retrieval system