Puma concolor (puma): 112854981 Help Entry 112854981         CDS       T08890                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pcoo  Puma concolor (puma) Pathway pcoo01522   Endocrine resistance pcoo04010   MAPK signaling pathway pcoo04024   cAMP signaling pathway pcoo04210   Apoptosis pcoo04380   Osteoclast differentiation pcoo04620   Toll-like receptor signaling pathway pcoo04657   IL-17 signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04662   B cell receptor signaling pathway pcoo04668   TNF signaling pathway pcoo04713   Circadian entrainment pcoo04725   Cholinergic synapse pcoo04728   Dopaminergic synapse pcoo04915   Estrogen signaling pathway pcoo04917   Prolactin signaling pathway pcoo04921   Oxytocin signaling pathway pcoo04926   Relaxin signaling pathway pcoo04928   Parathyroid hormone synthesis, secretion and action pcoo04932   Non-alcoholic fatty liver disease pcoo04935   Growth hormone synthesis, secretion and action pcoo05031   Amphetamine addiction pcoo05132   Salmonella infection pcoo05133   Pertussis pcoo05135   Yersinia infection pcoo05140   Leishmaniasis pcoo05142   Chagas disease pcoo05161   Hepatitis B pcoo05162   Measles pcoo05166   Human T-cell leukemia virus 1 infection pcoo05167   Kaposi sarcoma-associated herpesvirus infection pcoo05170   Human immunodeficiency virus 1 infection pcoo05171   Coronavirus disease - COVID-19 pcoo05200   Pathways in cancer pcoo05207   Chemical carcinogenesis - receptor activation pcoo05208   Chemical carcinogenesis - reactive oxygen species pcoo05210   Colorectal cancer pcoo05224   Breast cancer pcoo05231   Choline metabolism in cancer pcoo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcoo05323   Rheumatoid arthritis pcoo05417   Lipid and atherosclerosis pcoo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112854981 (FOS)    04668 TNF signaling pathway     112854981 (FOS)    04024 cAMP signaling pathway     112854981 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     112854981 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112854981 (FOS)    04660 T cell receptor signaling pathway     112854981 (FOS)    04658 Th1 and Th2 cell differentiation     112854981 (FOS)    04659 Th17 cell differentiation     112854981 (FOS)    04657 IL-17 signaling pathway     112854981 (FOS)    04662 B cell receptor signaling pathway     112854981 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     112854981 (FOS)    04917 Prolactin signaling pathway     112854981 (FOS)    04921 Oxytocin signaling pathway     112854981 (FOS)    04926 Relaxin signaling pathway     112854981 (FOS)    04935 Growth hormone synthesis, secretion and action     112854981 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     112854981 (FOS)   09156 Nervous system    04725 Cholinergic synapse     112854981 (FOS)    04728 Dopaminergic synapse     112854981 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     112854981 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     112854981 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112854981 (FOS)    05207 Chemical carcinogenesis - receptor activation     112854981 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     112854981 (FOS)    05231 Choline metabolism in cancer     112854981 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112854981 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     112854981 (FOS)    05224 Breast cancer     112854981 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     112854981 (FOS)    05170 Human immunodeficiency virus 1 infection     112854981 (FOS)    05161 Hepatitis B     112854981 (FOS)    05171 Coronavirus disease - COVID-19     112854981 (FOS)    05162 Measles     112854981 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     112854981 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     112854981 (FOS)    05135 Yersinia infection     112854981 (FOS)    05133 Pertussis     112854981 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     112854981 (FOS)    05142 Chagas disease     112854981 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     112854981 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     112854981 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112854981 (FOS)    05418 Fluid shear stress and atherosclerosis     112854981 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     112854981 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     112854981 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcoo03000]     112854981 (FOS)    04131 Membrane trafficking [BR:pcoo04131]     112854981 (FOS) Transcription factors [BR:pcoo03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     112854981 (FOS) Membrane trafficking [BR:pcoo04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     112854981 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  112854981 NCBI-ProteinID:  XP_025774299 UniProt:  A0A6P6HEV3 LinkDB All DBs Position Unknown AA seq 381 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYSRAGVVKTVTAGGR AQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSAL QTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAF TLPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFY AADWEPLHGGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCGAAHR KGSSSNEPSSDSLSSPTLLAL NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaatctctcctactaccactcaccggccgactccttctccagcatg ggctctcctgtcaatgcgcaggacttctgcacggatctggccgtctccagcgccaacttt atcccaacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggctccttctcagaccagagccccccacccctatggagtccccgcc ccctccgccggggcttactccagggctggagtcgtgaagaccgtgaccgcaggaggccga gctcagagcattggcaggaggggcaaagtggaacagttgtccccagaagaagaagagaaa aggagaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccggaggcgg gagctcacggatacgctgcaagcggagacagaccaactagaagatgagaagtctgctttg cagactgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagct caccgacccgcctgcaagatccccgatgacctgggcttcccggaagaaatgtctgtggct tccctagatctgagcgggggtctgccggaagctgccacccccgagtcggaggaggctttc accctgcccctcctcaatgatcctgagcccaagccctccgtggagccggtcaagagcatc agcagcatggagctgaaggccgagccctttgatgacttcctgttcccagcatcgtccagg cccagcggctccgagaccgcccgctctgtgccagacatggacctgtctggttccttctat gcagcagactgggagcccctgcatggtggctccctggggatggggcccatggccacagag ctggagcctctgtgcaccccggtggtcacctgtactcctagctgcactacttacacgtct tccttcgtcttcacctaccctgaggctgactccttccccagctgtggggctgctcaccgc aagggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacgctgctggcc ctgtga

DBGET integrated database retrieval system