Puma concolor (puma): 112861021 Help Entry 112861021         CDS       T08890                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism pcoo  Puma concolor (puma) Pathway pcoo04060   Cytokine-cytokine receptor interaction pcoo04151   PI3K-Akt signaling pathway pcoo04630   JAK-STAT signaling pathway pcoo04640   Hematopoietic cell lineage pcoo04657   IL-17 signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04664   Fc epsilon RI signaling pathway pcoo04672   Intestinal immune network for IgA production pcoo05140   Leishmaniasis pcoo05200   Pathways in cancer pcoo05310   Asthma pcoo05320   Autoimmune thyroid disease pcoo05321   Inflammatory bowel disease pcoo05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112861021 (IL4)    04151 PI3K-Akt signaling pathway     112861021 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112861021 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     112861021 (IL4)    04660 T cell receptor signaling pathway     112861021 (IL4)    04658 Th1 and Th2 cell differentiation     112861021 (IL4)    04659 Th17 cell differentiation     112861021 (IL4)    04657 IL-17 signaling pathway     112861021 (IL4)    04664 Fc epsilon RI signaling pathway     112861021 (IL4)    04672 Intestinal immune network for IgA production     112861021 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112861021 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     112861021 (IL4)   09163 Immune disease    05310 Asthma     112861021 (IL4)    05320 Autoimmune thyroid disease     112861021 (IL4)    05321 Inflammatory bowel disease     112861021 (IL4)    05330 Allograft rejection     112861021 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112861021 (IL4)    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112861021 (IL4) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interleukins    112861021 (IL4) Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Cytokines    112861021 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 HHH_9 Ribosomal_S19e AAR2 FAD_SOX Motif Other DBs NCBI-GeneID:  112861021 NCBI-ProteinID:  XP_025780053 UniProt:  A0A6P6HXZ0 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE RLKAIMQKKYSKH NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc ctcacagcgagaaacgactcgtgcatggagctgaccgtcatggacgtcttggcagcccca aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat acacatcacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa aggctaaaagcgatcatgcaaaagaaatactcaaagcactga

DBGET integrated database retrieval system