Puma concolor (puma): 112863468 Help Entry 112863468         CDS       T08890                                  Symbol IFNG Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism pcoo  Puma concolor (puma) Pathway pcoo03050   Proteasome pcoo04060   Cytokine-cytokine receptor interaction pcoo04066   HIF-1 signaling pathway pcoo04217   Necroptosis pcoo04350   TGF-beta signaling pathway pcoo04380   Osteoclast differentiation pcoo04612   Antigen processing and presentation pcoo04630   JAK-STAT signaling pathway pcoo04650   Natural killer cell mediated cytotoxicity pcoo04657   IL-17 signaling pathway pcoo04658   Th1 and Th2 cell differentiation pcoo04659   Th17 cell differentiation pcoo04660   T cell receptor signaling pathway pcoo04940   Type I diabetes mellitus pcoo05140   Leishmaniasis pcoo05142   Chagas disease pcoo05143   African trypanosomiasis pcoo05144   Malaria pcoo05145   Toxoplasmosis pcoo05146   Amoebiasis pcoo05152   Tuberculosis pcoo05160   Hepatitis C pcoo05164   Influenza A pcoo05168   Herpes simplex virus 1 infection pcoo05200   Pathways in cancer pcoo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcoo05321   Inflammatory bowel disease pcoo05322   Systemic lupus erythematosus pcoo05323   Rheumatoid arthritis pcoo05330   Allograft rejection pcoo05332   Graft-versus-host disease pcoo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     112863468 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     112863468 (IFNG)    04630 JAK-STAT signaling pathway     112863468 (IFNG)    04066 HIF-1 signaling pathway     112863468 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112863468 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112863468 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     112863468 (IFNG)    04612 Antigen processing and presentation     112863468 (IFNG)    04660 T cell receptor signaling pathway     112863468 (IFNG)    04658 Th1 and Th2 cell differentiation     112863468 (IFNG)    04659 Th17 cell differentiation     112863468 (IFNG)    04657 IL-17 signaling pathway     112863468 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     112863468 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112863468 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     112863468 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     112863468 (IFNG)    05164 Influenza A     112863468 (IFNG)    05168 Herpes simplex virus 1 infection     112863468 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     112863468 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     112863468 (IFNG)    05144 Malaria     112863468 (IFNG)    05145 Toxoplasmosis     112863468 (IFNG)    05140 Leishmaniasis     112863468 (IFNG)    05142 Chagas disease     112863468 (IFNG)    05143 African trypanosomiasis     112863468 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     112863468 (IFNG)    05323 Rheumatoid arthritis     112863468 (IFNG)    05321 Inflammatory bowel disease     112863468 (IFNG)    05330 Allograft rejection     112863468 (IFNG)    05332 Graft-versus-host disease     112863468 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     112863468 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     112863468 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pcoo03051]     112863468 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcoo04052]     112863468 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pcoo00536]     112863468 (IFNG) Proteasome [BR:pcoo03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     112863468 (IFNG) Cytokines and neuropeptides [BR:pcoo04052]  Cytokines   Interferons    112863468 (IFNG) Glycosaminoglycan binding proteins [BR:pcoo00536]  Heparan sulfate / Heparin   Cytokines    112863468 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma COG6_C Motif Other DBs NCBI-GeneID:  112863468 NCBI-ProteinID:  XP_025782368 UniProt:  A0A6P6I5H4 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MNYTSFIFAFQLCIILCSSGYYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLI QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt tattactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca agtaatccagatgtagcagatggtgggtcgctttttgtagacattttgaagaactggaaa gaggagagtgataaaacaataattcaaagccaaattgtctccttctacctgaaaatgttt gaaaatctgaaagatgatgaccagcgcattcaaaggagcatggacaccatcaaggaagac atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg atgaatgatctctcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgttt cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system