Puma concolor (puma): 112863816 Help Entry 112863816         CDS       T08890                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pcoo  Puma concolor (puma) Pathway pcoo04010   MAPK signaling pathway pcoo04014   Ras signaling pathway pcoo04015   Rap1 signaling pathway pcoo04024   cAMP signaling pathway pcoo04062   Chemokine signaling pathway pcoo04510   Focal adhesion pcoo04520   Adherens junction pcoo04611   Platelet activation pcoo04670   Leukocyte transendothelial migration pcoo04720   Long-term potentiation pcoo04722   Neurotrophin signaling pathway pcoo04934   Cushing syndrome pcoo04972   Pancreatic secretion pcoo05211   Renal cell carcinoma pcoo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcoo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112863816 (RAP1B)    04014 Ras signaling pathway     112863816 (RAP1B)    04015 Rap1 signaling pathway     112863816 (RAP1B)    04024 cAMP signaling pathway     112863816 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     112863816 (RAP1B)    04520 Adherens junction     112863816 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     112863816 (RAP1B)    04670 Leukocyte transendothelial migration     112863816 (RAP1B)    04062 Chemokine signaling pathway     112863816 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     112863816 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     112863816 (RAP1B)    04722 Neurotrophin signaling pathway     112863816 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     112863816 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112863816 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     112863816 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcoo04147]     112863816 (RAP1B)    04031 GTP-binding proteins [BR:pcoo04031]     112863816 (RAP1B) Exosome [BR:pcoo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112863816 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    112863816 (RAP1B)   Exosomal proteins of colorectal cancer cells    112863816 (RAP1B) GTP-binding proteins [BR:pcoo04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     112863816 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  112863816 NCBI-ProteinID:  XP_025782715 UniProt:  A0A6P6I3L5 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system