Plasmodium coatneyi: PCOAH_00021320 Help Entry PCOAH_00021320    CDS       T10133                                  Name (RefSeq) Ubiquitin--protein ligase   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pcot  Plasmodium coatneyi Pathway pcot03420   Nucleotide excision repair pcot04120   Ubiquitin mediated proteolysis pcot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pcot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     PCOAH_00021320    04120 Ubiquitin mediated proteolysis     PCOAH_00021320   09124 Replication and repair    03420 Nucleotide excision repair     PCOAH_00021320  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcot04121]     PCOAH_00021320    03400 DNA repair and recombination proteins [BR:pcot03400]     PCOAH_00021320 Enzymes [BR:pcot01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      PCOAH_00021320 Ubiquitin system [BR:pcot04121]  Ubiquitin ligases (E3)   UBL E3 ligases    PCOAH_00021320   Multi subunit type E3    SCF complex     Ring finger protein      PCOAH_00021320    Cul2 complex      PCOAH_00021320    Cul3 complex      PCOAH_00021320    Cul4 complex      PCOAH_00021320    Cul7 complex      PCOAH_00021320    Cul8 complex      PCOAH_00021320    Cul9 complex      PCOAH_00021320 DNA repair and recombination proteins [BR:pcot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       PCOAH_00021320     TCR (transcription coupled repair) factors      Cul4-CSA complex       PCOAH_00021320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-HC5HC2H zf-RING_11 DZR zf-RING_16 Motif Other DBs NCBI-GeneID:  30908858 NCBI-ProteinID:  XP_019914500 UniProt:  A0A1B1DYX7 LinkDB All DBs Position 8:complement(<1039689..>1040015) Genome browser AA seq 108 aa AA seqDB search MAENKGKEDNEIFKIHKWSGVAAWSWDISVDNCAICRNHIMDLCIECQAKLNENDGNDKD KKMDKDSCTIAWGVCNHAFHLHCISRWIKARQVCPLDNTPWEFQKASN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggccgagaacaaagggaaagaagacaatgagattttcaaaattcacaaatggtcaggt gtggcggcctggtcctgggacatcagcgtagataactgtgccatttgcagaaaccatata atggatttatgcatcgaatgtcaagcaaagttaaacgaaaatgatggaaacgataaggac aagaaaatggacaaggacagctgcacgatagcgtggggtgtgtgcaatcatgcctttcac cttcactgcatatcgaggtggattaaggccagacaggtttgtcccctggataacacgcct tgggagttccagaaggcatcgaactga

DBGET integrated database retrieval system