Pyrus communis (pear): 137734081 Help Entry 137734081         CDS       T10779                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pcox  Pyrus communis (pear) Pathway pcox03420   Nucleotide excision repair pcox04120   Ubiquitin mediated proteolysis pcox04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pcox00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     137734081    04120 Ubiquitin mediated proteolysis     137734081   09124 Replication and repair    03420 Nucleotide excision repair     137734081  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcox04121]     137734081    03400 DNA repair and recombination proteins [BR:pcox03400]     137734081 Enzymes [BR:pcox01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      137734081 Ubiquitin system [BR:pcox04121]  Ubiquitin ligases (E3)   UBL E3 ligases    137734081   Multi subunit type E3    SCF complex     Ring finger protein      137734081    Cul2 complex      137734081    Cul3 complex      137734081    Cul4 complex      137734081    Cul7 complex      137734081    Cul8 complex      137734081    Cul9 complex      137734081 DNA repair and recombination proteins [BR:pcox03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       137734081     TCR (transcription coupled repair) factors      Cul4-CSA complex       137734081 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  137734081 NCBI-ProteinID:  XP_068329454 LinkDB All DBs Position 5:15530248..15532579 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMIPAGEGSSSAGPSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcaacactggactcagatgttccgatgattcccgcaggcgagggttcgagcagtgca ggtccttcttcgaccaagaagcccaagcgattcgagatcaagaagtggaatgctgttgct ctctgggcttgggatattgtggttgataactgtgccatttgcaggaatcatatcatggat ctctgcattgagtgccaagcaaaccaggcaagtgccacaagcgaggagtgcacggttgct tggggggtttgtaaccatgcattccacttccactgcataagccgatggctcaagactcga caagtgtgcccattggataacagcgagtgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system