Pelecanus crispus (Dalmatian pelican): 104036704 Help Entry 104036704         CDS       T08340                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism pcri  Pelecanus crispus (Dalmatian pelican) Pathway pcri00670   One carbon pool by folate pcri00790   Folate biosynthesis pcri01100   Metabolic pathways pcri01240   Biosynthesis of cofactors pcri04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:pcri00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     104036704 (DHFR)    00670 One carbon pool by folate     104036704 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     104036704 (DHFR) Enzymes [BR:pcri01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      104036704 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  104036704 NCBI-ProteinID:  XP_009488664 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTTTSHVEGKQNALIMGKKTWFSIPEKNRPLKDRINIVLSRELKETPKGAHYLSKSLDDA LALLDSPELKSKVDMVWIVGGTSVYKAAMEKPINHRLFVTRILHEFESDTFFPEIDYKDY RLLTEYPGVPADIQEENGIQYKFEVYEKAVLAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgactaccacatcccatgtggaaggtaaacagaatgctctgataatgggtaaaaaaacc tggttctccattcctgagaagaatcgtcccttaaaagacagaattaatatagtgctcagc agggagctcaaggaaaccccaaaaggagcacattacctttccaaaagtctggatgatgct ttagctcttttggattcaccagagttaaaaagtaaagtagacatggtttggatcgtcgga ggcacttcagtttacaaggcagcaatggagaagccaattaatcaccgattgtttgtgaca agaattttgcatgagtttgaaagtgacacattttttccagaaattgactacaaggactac agacttctcactgaatacccgggtgtccctgctgatatccaggaagagaatggcatccag tacaaatttgaagtgtatgaaaaagctgtcttggcacaataa

DBGET integrated database retrieval system