Phascolarctos cinereus (koala): 110199211 Help Entry 110199211         CDS       T05867                                  Name (RefSeq) interferon beta-like   KO K05415   interferon beta Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04151   PI3K-Akt signaling pathway pcw04217   Necroptosis pcw04380   Osteoclast differentiation pcw04620   Toll-like receptor signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04622   RIG-I-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw04630   JAK-STAT signaling pathway pcw04650   Natural killer cell mediated cytotoxicity pcw04668   TNF signaling pathway pcw04936   Alcoholic liver disease pcw05135   Yersinia infection pcw05142   Chagas disease pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05161   Hepatitis B pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05165   Human papillomavirus infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05168   Herpes simplex virus 1 infection pcw05169   Epstein-Barr virus infection pcw05170   Human immunodeficiency virus 1 infection pcw05171   Coronavirus disease - COVID-19 pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110199211    04668 TNF signaling pathway     110199211    04151 PI3K-Akt signaling pathway     110199211   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110199211  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110199211  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110199211    04621 NOD-like receptor signaling pathway     110199211    04622 RIG-I-like receptor signaling pathway     110199211    04623 Cytosolic DNA-sensing pathway     110199211    04650 Natural killer cell mediated cytotoxicity     110199211   09158 Development and regeneration    04380 Osteoclast differentiation     110199211  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110199211    05161 Hepatitis B     110199211    05160 Hepatitis C     110199211    05171 Coronavirus disease - COVID-19     110199211    05164 Influenza A     110199211    05162 Measles     110199211    05168 Herpes simplex virus 1 infection     110199211    05163 Human cytomegalovirus infection     110199211    05167 Kaposi sarcoma-associated herpesvirus infection     110199211    05169 Epstein-Barr virus infection     110199211    05165 Human papillomavirus infection     110199211   09171 Infectious disease: bacterial    05135 Yersinia infection     110199211    05152 Tuberculosis     110199211   09174 Infectious disease: parasitic    05142 Chagas disease     110199211   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110199211   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110199211  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110199211 Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interferons    110199211 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DnaD_N DUF4164 Motif Other DBs NCBI-GeneID:  110199211 NCBI-ProteinID:  XP_020829610 UniProt:  A0A6P5J8A6 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MANNSVLQLALLLLLSAAVSSKGSLRFHQRRTNHRSLSLLNKMIGKLHPECLPEKMDFKT PREIAKPRQCQKENATMVIHEVLQQIFLLFSGKNASPGVDKTIIETFLSGIHQQMVHLEM ALEEEMDQANSTWGSEESISHLNIYYQGITNYLKSKEYSSCAWKRVQVEIRKNFFFLFKL TECLKN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggccaacaacagtgtcttacaattggctcttctcctgctcctctctgctgctgtctct tctaaaggctcacttcgcttccatcaaagaagaaccaatcacaggagtttgagtctcctg aataaaatgattggaaaacttcatccagaatgtctaccggagaaaatggacttcaagacc ccccgggagattgcaaagcctaggcaatgccagaaggagaatgccaccatggtcatccat gaggtgctccagcaaatcttcctcctgttcagtggcaaaaatgccagccctggtgtggat aagaccatcattgagacattcctcagtggaatccatcagcaaatggtgcatctggaaatg gctttggaggaagagatggaccaggccaatagcacctgggggagtgaagagagcatctcg catctcaacatttattatcaaggaataacgaactatctgaaaagcaaagagtactccagc tgtgcctggaagagagtccaggtggaaatcagaaagaattttttcttccttttcaaattg acagaatgtctaaagaactga

DBGET integrated database retrieval system