Phascolarctos cinereus (koala): 110205825 Help Entry 110205825         CDS       T05867                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism pcw  Phascolarctos cinereus (koala) Pathway pcw03420   Nucleotide excision repair pcw04066   HIF-1 signaling pathway pcw04110   Cell cycle pcw04114   Oocyte meiosis pcw04120   Ubiquitin mediated proteolysis pcw04141   Protein processing in endoplasmic reticulum pcw04310   Wnt signaling pathway pcw04350   TGF-beta signaling pathway pcw04710   Circadian rhythm pcw05170   Human immunodeficiency virus 1 infection pcw05200   Pathways in cancer pcw05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110205825 (RBX1)    04120 Ubiquitin mediated proteolysis     110205825 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     110205825 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110205825 (RBX1)    04350 TGF-beta signaling pathway     110205825 (RBX1)    04066 HIF-1 signaling pathway     110205825 (RBX1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     110205825 (RBX1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110205825 (RBX1)   09162 Cancer: specific types    05211 Renal cell carcinoma     110205825 (RBX1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110205825 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:pcw04121]     110205825 (RBX1)    03400 DNA repair and recombination proteins [BR:pcw03400]     110205825 (RBX1) Enzymes [BR:pcw01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110205825 (RBX1) Ubiquitin system [BR:pcw04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110205825 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      110205825 (RBX1)    Cul2 complex      110205825 (RBX1)    Cul3 complex      110205825 (RBX1)    Cul4 complex      110205825 (RBX1)    Cul7 complex      110205825 (RBX1)    Cul8 complex      110205825 (RBX1)    Cul9 complex      110205825 (RBX1) DNA repair and recombination proteins [BR:pcw03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110205825 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       110205825 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  110205825 NCBI-ProteinID:  XP_020838349 UniProt:  A0A6P5JZT5 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcgatggatgtggacacccccagtggcaccaacagcggcgccggcaagaag cgctttgaagtgaaaaagtggaatgcagtggccctctgggcctgggatattgtggttgac aactgcgccatctgcagaaaccacattatggacctttgtatagaatgtcaagccaaccag gcgtctgccacctctgaagaatgtaccgtcgcgtggggcgtctgcaatcacgccttccac ttccactgcatctctcgctggctcaaaaccaggcaggtgtgcccgctggacaacagagag tgggagtttcagaagtatgggcattag

DBGET integrated database retrieval system