Phascolarctos cinereus (koala): 110208312 Help Entry 110208312         CDS       T05867                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01522   Endocrine resistance pcw04010   MAPK signaling pathway pcw04024   cAMP signaling pathway pcw04210   Apoptosis pcw04380   Osteoclast differentiation pcw04620   Toll-like receptor signaling pathway pcw04657   IL-17 signaling pathway pcw04658   Th1 and Th2 cell differentiation pcw04659   Th17 cell differentiation pcw04660   T cell receptor signaling pathway pcw04662   B cell receptor signaling pathway pcw04668   TNF signaling pathway pcw04713   Circadian entrainment pcw04725   Cholinergic synapse pcw04728   Dopaminergic synapse pcw04915   Estrogen signaling pathway pcw04917   Prolactin signaling pathway pcw04921   Oxytocin signaling pathway pcw04926   Relaxin signaling pathway pcw04928   Parathyroid hormone synthesis, secretion and action pcw04932   Non-alcoholic fatty liver disease pcw04935   Growth hormone synthesis, secretion and action pcw05031   Amphetamine addiction pcw05132   Salmonella infection pcw05133   Pertussis pcw05135   Yersinia infection pcw05140   Leishmaniasis pcw05142   Chagas disease pcw05161   Hepatitis B pcw05162   Measles pcw05166   Human T-cell leukemia virus 1 infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05170   Human immunodeficiency virus 1 infection pcw05171   Coronavirus disease - COVID-19 pcw05200   Pathways in cancer pcw05207   Chemical carcinogenesis - receptor activation pcw05208   Chemical carcinogenesis - reactive oxygen species pcw05210   Colorectal cancer pcw05224   Breast cancer pcw05231   Choline metabolism in cancer pcw05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcw05323   Rheumatoid arthritis pcw05417   Lipid and atherosclerosis pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110208312 (FOS)    04668 TNF signaling pathway     110208312 (FOS)    04024 cAMP signaling pathway     110208312 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     110208312 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110208312 (FOS)    04660 T cell receptor signaling pathway     110208312 (FOS)    04658 Th1 and Th2 cell differentiation     110208312 (FOS)    04659 Th17 cell differentiation     110208312 (FOS)    04657 IL-17 signaling pathway     110208312 (FOS)    04662 B cell receptor signaling pathway     110208312 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     110208312 (FOS)    04917 Prolactin signaling pathway     110208312 (FOS)    04921 Oxytocin signaling pathway     110208312 (FOS)    04926 Relaxin signaling pathway     110208312 (FOS)    04935 Growth hormone synthesis, secretion and action     110208312 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     110208312 (FOS)   09156 Nervous system    04725 Cholinergic synapse     110208312 (FOS)    04728 Dopaminergic synapse     110208312 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     110208312 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     110208312 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110208312 (FOS)    05207 Chemical carcinogenesis - receptor activation     110208312 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     110208312 (FOS)    05231 Choline metabolism in cancer     110208312 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110208312 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     110208312 (FOS)    05224 Breast cancer     110208312 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110208312 (FOS)    05170 Human immunodeficiency virus 1 infection     110208312 (FOS)    05161 Hepatitis B     110208312 (FOS)    05171 Coronavirus disease - COVID-19     110208312 (FOS)    05162 Measles     110208312 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     110208312 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     110208312 (FOS)    05135 Yersinia infection     110208312 (FOS)    05133 Pertussis     110208312 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     110208312 (FOS)    05142 Chagas disease     110208312 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     110208312 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     110208312 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110208312 (FOS)    05418 Fluid shear stress and atherosclerosis     110208312 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110208312 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110208312 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pcw03000]     110208312 (FOS)    04131 Membrane trafficking [BR:pcw04131]     110208312 (FOS) Transcription factors [BR:pcw03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     110208312 (FOS) Membrane trafficking [BR:pcw04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     110208312 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  110208312 NCBI-ProteinID:  XP_020841919 UniProt:  A0A6P5KA93 LinkDB All DBs Position Unknown AA seq 378 aa AA seqDB search MMYQGFNTEYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNSQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLISSVAPSQTRVHPYGVSTPSAAVYSRAGIVKTTGGRGQS IGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTE IANLLKEKEKLEFILAAHRPACKIPDDLGFPEEITAASLDLTVGLTEAATPESEEAFSLP LLQETEPKSSVEPVKNINSLELKAEPFDDFLFPASSRPGGLESTARSVPDMDLAGSFYAA DWEPLHSSSLGMGVAADLEPLCTPVVTCTPTCTTYTSSFVFTYPEADSFPSCAAAHRKGS SSNEPSSDSLSSPTLLAL NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt atgatgtaccaaggattcaacaccgaatacgaagcatcctcctcccgatgcagcagcgct tccccggcgggggacagcctctcttattaccactccccggctgactccttctccagcatg ggctctcctgtcaattcacaggatttctgcacagatctggctgtttccagtgccaacttt atacctactgtgacggctatatcgacaagcccagacctgcagtggctggtccagcccacc ctcatctcttctgtagccccatcccagaccagagtccatccttacggagtctctactcct tcagctgctgtttactctagggctggtattgtgaagactacaggaggcagagggcaaagc attggcagaaggggcaaagtcgaacagctttccccagaagaagaggagaaaagaagaatc aggagagaaaggaataagatggctgcagccaaatgccgtaacagaaggagagaactgact gacacactccaagcggagacagaccaactagaagatgaaaaatctgctttgcaaactgag atagccaacctgctaaaggagaaggaaaagctggaattcatcctggcagcccatcgacct gcctgcaagatacctgatgatttgggcttcccagaagaaataacagctgcctcccttgac ctcactgttggcctgactgaggctgcaaccccagagtcagaggaagccttctccttgccc ctcttgcaggagactgaacccaaatcctctgtggagccagtcaagaacatcaacagtttg gagctgaaggctgagccctttgatgacttcctcttcccagcttcctccaggcctggtggt ttagaatctactgcacgttcagtgcctgacatggacctggctggctccttctatgcagca gactgggaacctctgcatagcagctccctggggatgggagtagcagctgacctagagcca ctgtgcaccccagtggtcacctgcacgcctacctgcaccacctatacgtcttccttcgtc ttcacctacccagaagctgactccttccccagctgtgcggctgctcaccgtaagggcagt agtagcaatgagccctcttctgactcactcagctcccctacgctgctggctttgtga

DBGET integrated database retrieval system