Phascolarctos cinereus (koala): 110209790 Help Entry 110209790         CDS       T05867                                  Name (RefSeq) permeability factor 2-like   KO K05505   C-X-C motif chemokine 1/2/3 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04062   Chemokine signaling pathway pcw04064   NF-kappa B signaling pathway pcw04621   NOD-like receptor signaling pathway pcw04657   IL-17 signaling pathway pcw04668   TNF signaling pathway pcw04936   Alcoholic liver disease pcw05134   Legionellosis pcw05146   Amoebiasis pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05323   Rheumatoid arthritis pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     110209790    04668 TNF signaling pathway     110209790   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110209790    04061 Viral protein interaction with cytokine and cytokine receptor     110209790  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110209790    04657 IL-17 signaling pathway     110209790    04062 Chemokine signaling pathway     110209790  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     110209790   09171 Infectious disease: bacterial    05134 Legionellosis     110209790   09174 Infectious disease: parasitic    05146 Amoebiasis     110209790   09163 Immune disease    05323 Rheumatoid arthritis     110209790   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110209790   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110209790  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110209790 Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Chemokines    110209790 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110209790 NCBI-ProteinID:  XP_020844140 UniProt:  A0A6P5KF11 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MEHGESQHQRVSAQLALALSSSELHAPNSSTMSSSLRQISCLFLLCLLSGLLTQSVRLAS GAPVANELRCQCLQTVQGVPYKTIANLKVIPAGPHCSNLEVIATQKNGNELCLNPAAPQV KKIVEKVLKSSN NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggagcatggggagtcacagcaccaaagagtctcggcacagctagccctcgctctctcc tcttccgagctccacgcaccaaactcctccaccatgagcagcagtctccgccagatttct tgtctcttcctcctgtgtctgctctctgggctgctgacgcagtccgtccggctagccagc ggagcgcccgtggccaatgagctacgttgccagtgtctgcagaccgtgcagggagttccc tacaagaccatcgccaacctgaaggtgatcccagccggtccccactgctccaacctcgaa gtcatagccactcagaagaatggaaatgaactttgccttaaccccgcggccccccaagtt aagaaaatagtggagaaagtgctgaaaagctccaattag

DBGET integrated database retrieval system