Phascolarctos cinereus (koala): 110210675 Help Entry 110210675         CDS       T05867                                  Symbol IL18 Name (RefSeq) interleukin-18   KO K05482   interleukin 18 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04621   NOD-like receptor signaling pathway pcw04623   Cytosolic DNA-sensing pathway pcw05132   Salmonella infection pcw05134   Legionellosis pcw05135   Yersinia infection pcw05143   African trypanosomiasis pcw05144   Malaria pcw05152   Tuberculosis pcw05164   Influenza A pcw05321   Inflammatory bowel disease pcw05323   Rheumatoid arthritis pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110210675 (IL18)    04061 Viral protein interaction with cytokine and cytokine receptor     110210675 (IL18)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110210675 (IL18)    04623 Cytosolic DNA-sensing pathway     110210675 (IL18)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     110210675 (IL18)   09171 Infectious disease: bacterial    05132 Salmonella infection     110210675 (IL18)    05135 Yersinia infection     110210675 (IL18)    05134 Legionellosis     110210675 (IL18)    05152 Tuberculosis     110210675 (IL18)   09174 Infectious disease: parasitic    05144 Malaria     110210675 (IL18)    05143 African trypanosomiasis     110210675 (IL18)   09163 Immune disease    05323 Rheumatoid arthritis     110210675 (IL18)    05321 Inflammatory bowel disease     110210675 (IL18)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110210675 (IL18)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110210675 (IL18) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interleukins    110210675 (IL18) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 Motif Other DBs NCBI-GeneID:  110210675 NCBI-ProteinID:  XP_020845416 UniProt:  A0A6P5KLB6 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MTDEMYCEPDDNAIDLVEIEFRDGTLYFKAEDDDHLESDDFRKLGGPKNAILRNLNNQVL MKKSGMDIAVLEDMTDCEIQANAPQTVFIMQAYKETVPKGLAIAILVRSKNQIYSLSCQN KELQFKEGAAPNHIASTTSDFIFYQKKVIGHEKMQFESSLYPGYFLACEKEQQGYFKLVL KEGCEEVDKFMMFIVQYC NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgactgatgaaatgtactgtgagccggatgacaatgctatcgaccttgtagagatagag tttcgagatggtacactttacttcaaagctgaagatgatgatcacctggaatcagatgat ttccgcaagctcggaggccccaaaaatgcaatcttaagaaacttgaacaatcaagttctc atgaaaaaaagtgggatggacatagctgtactcgaggatatgactgattgtgagattcaa gcaaatgcaccccaaactgtatttataatgcaagcctataaagagactgtacccaaaggc ttggcaatagccatcttggtgagaagtaaaaaccagatttacagtctgtcctgccagaac aaagaacttcaatttaaggaaggtgctgctccaaatcatattgcatctacaacaagtgat tttatattctaccaaaagaaggttataggccacgagaagatgcaatttgagtcttcattg tacccaggatattttctggcttgtgagaaggaacagcagggctattttaagcttgtttta aaagaaggctgtgaagaagtggataaatttatgatgtttattgttcagtattgctag

DBGET integrated database retrieval system