Phascolarctos cinereus (koala): 110210989 Help Entry 110210989         CDS       T05867                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism pcw  Phascolarctos cinereus (koala) Pathway pcw01522   Endocrine resistance pcw04110   Cell cycle pcw04115   p53 signaling pathway pcw04151   PI3K-Akt signaling pathway pcw04218   Cellular senescence pcw04530   Tight junction pcw04660   T cell receptor signaling pathway pcw04933   AGE-RAGE signaling pathway in diabetic complications pcw04934   Cushing syndrome pcw05160   Hepatitis C pcw05162   Measles pcw05163   Human cytomegalovirus infection pcw05164   Influenza A pcw05165   Human papillomavirus infection pcw05166   Human T-cell leukemia virus 1 infection pcw05167   Kaposi sarcoma-associated herpesvirus infection pcw05169   Epstein-Barr virus infection pcw05200   Pathways in cancer pcw05203   Viral carcinogenesis pcw05212   Pancreatic cancer pcw05214   Glioma pcw05218   Melanoma pcw05219   Bladder cancer pcw05220   Chronic myeloid leukemia pcw05222   Small cell lung cancer pcw05223   Non-small cell lung cancer pcw05224   Breast cancer pcw05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     110210989 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     110210989 (CDK4)    04115 p53 signaling pathway     110210989 (CDK4)    04218 Cellular senescence     110210989 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     110210989 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     110210989 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110210989 (CDK4)    05203 Viral carcinogenesis     110210989 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     110210989 (CDK4)    05225 Hepatocellular carcinoma     110210989 (CDK4)    05214 Glioma     110210989 (CDK4)    05220 Chronic myeloid leukemia     110210989 (CDK4)    05218 Melanoma     110210989 (CDK4)    05219 Bladder cancer     110210989 (CDK4)    05224 Breast cancer     110210989 (CDK4)    05222 Small cell lung cancer     110210989 (CDK4)    05223 Non-small cell lung cancer     110210989 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110210989 (CDK4)    05160 Hepatitis C     110210989 (CDK4)    05164 Influenza A     110210989 (CDK4)    05162 Measles     110210989 (CDK4)    05163 Human cytomegalovirus infection     110210989 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     110210989 (CDK4)    05169 Epstein-Barr virus infection     110210989 (CDK4)    05165 Human papillomavirus infection     110210989 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110210989 (CDK4)    04934 Cushing syndrome     110210989 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110210989 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:pcw01001]     110210989 (CDK4) Enzymes [BR:pcw01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      110210989 (CDK4) Protein kinases [BR:pcw01001]  Serine/threonine kinases: CMGC group   CDK family    110210989 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo Haspin_kinase ABC1 Kinase-like Motif Other DBs NCBI-GeneID:  110210989 NCBI-ProteinID:  XP_020845799 UniProt:  A0A6P5KJG1 LinkDB All DBs Position Unknown AA seq 304 aa AA seqDB search MDIPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVKVPTGGGSGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPLETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSSGTVKLADFGLARIYSCQMALTPVVVTLWY RAPEVLLQSAYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLSKIFDLIGLPAEDDWPT DVSLPRGAFTPCSPQPLQSVVPELEGPGAQLLLEMLTFSPHKRISAFRALQHTYLQTAGE GNPE NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggacattcctcggtatgaaccagtggccgagattggtgttggtgcctatgggaccgtg tacaaggcccgtgacccccacagcggccacttcgtggcactcaagagcgtgaaagtcccg accggaggaggaagtggagggggcctgcctgtcagcactgtccgggaggtggccctcctt cggcggctggaggcctttgagcatcccaacgtggtccggctgatggatgtctgtgccact gcccgaactgaccgagagaccaaggtgaccctggtgtttgaacacgtggaccaagacctg aggacgtatctggacaaggcccctccaccagggctgcccttggagaccattaaggaccta atgagacagttcttaagaggcctagactttcttcatgccaactgcattgtccaccgtgac ctgaagccagaaaacatccttgtgactagtagtggaacagtcaagctggctgactttggc ttagcccggatctacagctgccagatggcactcacacctgtggtagtcactctctggtac cgggctcctgaggttctcctgcagtcagcatatgcaacacctgtggacatgtggagtgtt ggctgcatcttcgcagagatgttccgtaggaagcctctcttctgtggaaactctgaagct gaccagttaagcaaaatctttgacctgattgggctcccagcagaagatgattggcctact gatgtttctctgccccgtggagcctttactccttgtagtccccagcctttacagtctgtt gtgcctgagctggagggacctggagcacaactgctactggaaatgctgacctttagcccc cacaaacgaatctctgctttccgagctctgcaacacacttatctacagacagctggggaa gggaacccagaatga

DBGET integrated database retrieval system