Phascolarctos cinereus (koala): 110211041 Help Entry 110211041         CDS       T05867                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04010   MAPK signaling pathway pcw04014   Ras signaling pathway pcw04015   Rap1 signaling pathway pcw04024   cAMP signaling pathway pcw04062   Chemokine signaling pathway pcw04510   Focal adhesion pcw04517   IgSF CAM signaling pcw04520   Adherens junction pcw04611   Platelet activation pcw04670   Leukocyte transendothelial migration pcw04720   Long-term potentiation pcw04722   Neurotrophin signaling pathway pcw04934   Cushing syndrome pcw04972   Pancreatic secretion pcw05211   Renal cell carcinoma pcw05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110211041 (RAP1B)    04014 Ras signaling pathway     110211041 (RAP1B)    04015 Rap1 signaling pathway     110211041 (RAP1B)    04024 cAMP signaling pathway     110211041 (RAP1B)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     110211041 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     110211041 (RAP1B)    04520 Adherens junction     110211041 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     110211041 (RAP1B)    04670 Leukocyte transendothelial migration     110211041 (RAP1B)    04062 Chemokine signaling pathway     110211041 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     110211041 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     110211041 (RAP1B)    04722 Neurotrophin signaling pathway     110211041 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     110211041 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110211041 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     110211041 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcw04147]     110211041 (RAP1B)    04031 GTP-binding proteins [BR:pcw04031]     110211041 (RAP1B) Exosome [BR:pcw04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110211041 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    110211041 (RAP1B)   Exosomal proteins of colorectal cancer cells    110211041 (RAP1B) GTP-binding proteins [BR:pcw04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     110211041 (RAP1B) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  110211041 NCBI-ProteinID:  XP_020845881 UniProt:  A0A6P5KNA7 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagctagttgttcttggctcaggaggtgttggaaagtctgccctgact gtacagtttgttcaaggaatatttgttgaaaaatatgatcctacgatagaagattcatat agaaagcaagttgaagtagatgctcaacaatgcatgctcgaaatcttggacactgcagga acggaacaatttacggcaatgagagatttgtacatgaaaaatggacaaggctttgcgtta gtctactccatcacagcacagtccacgtttaatgatttacaagatcttcgagaacagata cttcgagttaaagacactgacgatgtgccaatgattcttgtgggtaataagtgtgacttg gaagatgaaagagttgtaggaaaagagcaaggacaaaacctagcaagacaatggaacaac tgtgcattcttagaatcttctgctaaatcaaagataaacgttaatgagatcttttatgac ctagtccggcaaattaacagaaaaactccagtgcctgggaaggcacgtaaaaagtcatca tgtcaattgctttaa

DBGET integrated database retrieval system