Phascolarctos cinereus (koala): 110211092 Help Entry 110211092         CDS       T05867                                  Symbol IFNG Name (RefSeq) interferon gamma isoform X1   KO K04687   interferon gamma Organism pcw  Phascolarctos cinereus (koala) Pathway pcw03050   Proteasome pcw04060   Cytokine-cytokine receptor interaction pcw04066   HIF-1 signaling pathway pcw04217   Necroptosis pcw04350   TGF-beta signaling pathway pcw04380   Osteoclast differentiation pcw04612   Antigen processing and presentation pcw04630   JAK-STAT signaling pathway pcw04650   Natural killer cell mediated cytotoxicity pcw04657   IL-17 signaling pathway pcw04658   Th1 and Th2 cell differentiation pcw04659   Th17 cell differentiation pcw04660   T cell receptor signaling pathway pcw04940   Type I diabetes mellitus pcw05140   Leishmaniasis pcw05142   Chagas disease pcw05143   African trypanosomiasis pcw05144   Malaria pcw05145   Toxoplasmosis pcw05146   Amoebiasis pcw05152   Tuberculosis pcw05160   Hepatitis C pcw05164   Influenza A pcw05168   Herpes simplex virus 1 infection pcw05200   Pathways in cancer pcw05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcw05321   Inflammatory bowel disease pcw05322   Systemic lupus erythematosus pcw05323   Rheumatoid arthritis pcw05330   Allograft rejection pcw05332   Graft-versus-host disease pcw05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pcw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     110211092 (IFNG)  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     110211092 (IFNG)    04630 JAK-STAT signaling pathway     110211092 (IFNG)    04066 HIF-1 signaling pathway     110211092 (IFNG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110211092 (IFNG)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     110211092 (IFNG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     110211092 (IFNG)    04612 Antigen processing and presentation     110211092 (IFNG)    04660 T cell receptor signaling pathway     110211092 (IFNG)    04658 Th1 and Th2 cell differentiation     110211092 (IFNG)    04659 Th17 cell differentiation     110211092 (IFNG)    04657 IL-17 signaling pathway     110211092 (IFNG)   09158 Development and regeneration    04380 Osteoclast differentiation     110211092 (IFNG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110211092 (IFNG)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110211092 (IFNG)   09172 Infectious disease: viral    05160 Hepatitis C     110211092 (IFNG)    05164 Influenza A     110211092 (IFNG)    05168 Herpes simplex virus 1 infection     110211092 (IFNG)   09171 Infectious disease: bacterial    05152 Tuberculosis     110211092 (IFNG)   09174 Infectious disease: parasitic    05146 Amoebiasis     110211092 (IFNG)    05144 Malaria     110211092 (IFNG)    05145 Toxoplasmosis     110211092 (IFNG)    05140 Leishmaniasis     110211092 (IFNG)    05142 Chagas disease     110211092 (IFNG)    05143 African trypanosomiasis     110211092 (IFNG)   09163 Immune disease    05322 Systemic lupus erythematosus     110211092 (IFNG)    05323 Rheumatoid arthritis     110211092 (IFNG)    05321 Inflammatory bowel disease     110211092 (IFNG)    05330 Allograft rejection     110211092 (IFNG)    05332 Graft-versus-host disease     110211092 (IFNG)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110211092 (IFNG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     110211092 (IFNG)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:pcw03051]     110211092 (IFNG)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110211092 (IFNG)    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110211092 (IFNG) Proteasome [BR:pcw03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     110211092 (IFNG) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interferons    110211092 (IFNG) Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Cytokines    110211092 (IFNG) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IFN-gamma DUF7774 RanGAP1_C Tup_N Motif Other DBs NCBI-GeneID:  110211092 NCBI-ProteinID:  XP_020845941 UniProt:  S5SA69 LinkDB All DBs Position Unknown AA seq 164 aa AA seqDB search MNYSSYLLASWLCVMLGYSQATIAEDLGTLMEYFQNGSTSSDISDNGTLFLNMMDRWKED GDKKILMSQIVTVYFKIFEIFKNNTVIKKSVENIKEDMIMKFFTNNTASKVNDFESVINT QVNDLRVQKKAIFELALIMNDLSNKPHLRKRKRRQNRKQGEIKQ NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgaattattcaagctacctcttagcatcctggctttgtgttatgttgggttattctcaa gctactatagcagaagacctaggaactcttatggaatactttcagaatggaagtacatca tctgatatatctgataatgggactcttttcttgaacatgatggatcgttggaaagaggat ggtgacaagaaaatcctaatgagccaaattgtcacagtttatttcaaaatctttgaaatc ttcaagaacaacaccgtcatcaaaaaaagtgtggagaatatcaaagaggatatgatcatg aaattcttcactaacaacactgccagcaaagtgaatgactttgaatctgtcatcaacact caggtgaatgacctcagagtccaaaagaaagctatatttgaactagcccttatcatgaat gacctctcaaacaaacctcatctaagaaagagaaaaagaagacagaacagaaaacaagga gaaatcaaacagtag

DBGET integrated database retrieval system