Phascolarctos cinereus (koala): 110219537 Help Entry 110219537         CDS       T05867                                  Symbol IL10 Name (RefSeq) interleukin-10   KO K05443   interleukin 10 Organism pcw  Phascolarctos cinereus (koala) Pathway pcw04060   Cytokine-cytokine receptor interaction pcw04061   Viral protein interaction with cytokine and cytokine receptor pcw04068   FoxO signaling pathway pcw04148   Efferocytosis pcw04625   C-type lectin receptor signaling pathway pcw04630   JAK-STAT signaling pathway pcw04660   T cell receptor signaling pathway pcw04672   Intestinal immune network for IgA production pcw05133   Pertussis pcw05135   Yersinia infection pcw05140   Leishmaniasis pcw05142   Chagas disease pcw05143   African trypanosomiasis pcw05144   Malaria pcw05145   Toxoplasmosis pcw05146   Amoebiasis pcw05150   Staphylococcus aureus infection pcw05152   Tuberculosis pcw05310   Asthma pcw05320   Autoimmune thyroid disease pcw05321   Inflammatory bowel disease pcw05322   Systemic lupus erythematosus pcw05330   Allograft rejection Brite KEGG Orthology (KO) [BR:pcw00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110219537 (IL10)    04068 FoxO signaling pathway     110219537 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110219537 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     110219537 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     110219537 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110219537 (IL10)    04660 T cell receptor signaling pathway     110219537 (IL10)    04672 Intestinal immune network for IgA production     110219537 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     110219537 (IL10)    05133 Pertussis     110219537 (IL10)    05150 Staphylococcus aureus infection     110219537 (IL10)    05152 Tuberculosis     110219537 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     110219537 (IL10)    05144 Malaria     110219537 (IL10)    05145 Toxoplasmosis     110219537 (IL10)    05140 Leishmaniasis     110219537 (IL10)    05142 Chagas disease     110219537 (IL10)    05143 African trypanosomiasis     110219537 (IL10)   09163 Immune disease    05310 Asthma     110219537 (IL10)    05322 Systemic lupus erythematosus     110219537 (IL10)    05320 Autoimmune thyroid disease     110219537 (IL10)    05321 Inflammatory bowel disease     110219537 (IL10)    05330 Allograft rejection     110219537 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcw04052]     110219537 (IL10)    00536 Glycosaminoglycan binding proteins [BR:pcw00536]     110219537 (IL10) Cytokines and neuropeptides [BR:pcw04052]  Cytokines   Interleukins    110219537 (IL10) Glycosaminoglycan binding proteins [BR:pcw00536]  Heparan sulfate / Heparin   Cytokines    110219537 (IL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL10 IL22 DUF6364 Phage_int_SAM_5 CLZ Motif Other DBs NCBI-GeneID:  110219537 NCBI-ProteinID:  XP_020858595 UniProt:  A0A6P5LJM7 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MKTSKVKDSTSKACSCKTELPASPQETHQSPTMSTLMLLFCLLCLTGSNLSSASGDSCST FSITLPDMLRELRAAFSNVKIYFQTRDKLETKLIDKSLLEELKSYLGCQALSEMIQFYLE EVMPQAEKNEVDIKENVGSLGEKLKALRLRLKRCHRFLPCEDRSRVVKQVKSTYEKLQER GVYKAMGDFDIFISYMEEYLTTHIRN NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atgaagaccagcaaagtgaaggacagtaccagtaaggcttgctcttgcaaaacagagcta ccagccagcccccaggagacacaccaaagccctaccatgtctaccttgatgctgctgttc tgcttgctctgcctgactggctccaacctcagttctgcctcaggggacagctgcagcacg ttctccatcacattgcctgacatgctccgagaacttcgagcagccttcagcaacgtgaag atctactttcaaaccagagacaagctcgaaaccaaattgatagacaaatctttgctggaa gaattaaagagttacctgggctgccaggccttgtcagagatgattcagttttacctggag gaagtgatgcctcaggcagagaagaatgaagtggacatcaaagagaacgtgggctcttta ggcgagaagctgaaggcactgagattgaggctcaaacgctgtcacagattcctgccctgt gaagataggagcagagttgtcaagcaagtcaagagcacctatgagaagctccaggaacga ggagtctacaaagcaatgggggattttgatatattcatcagctacatggaggaatacttg acgacgcatatcagaaactga

DBGET integrated database retrieval system